KEGG   Drosophila erecta: Dere_GG24630Help
Entry
Dere_GG24630      CDS       T01060                                 

Definition
GG24630 gene product from transcript GG24630-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dere_GG24630
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dere_GG24630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 768 aa AA seqDB search
MAAGMFTDREREAIVSNLTKDVQALREMVRSRESELVKLHREIHKLKSVLQQTTNNLNVT
RNEKAKTKLYSLPEQCSEQEDKERNPHLCSSCGMVLPTSPEFALEALSLGPLTPSTSAST
ASPSGSTSAEEVRPKAMPAAIKKQGVSAESCVQSMQQSYSIPIPKYDKDFSDKQQIKDAI
MDNDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLD
KMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLR
SVPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSP
EETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKD
YGDESRMLAMKHARESCRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQD
RVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACM
GGEIWTMLRDRGSFEDEAAQFIIGCVLQAYEYLHARGIIYRDLKPENLMLDERGYVKIVD
FGFAKQIGTSTKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPD
PMQTYNLILKGIDMIAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGF
DWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDADF
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggccgctggaatgtttactgatcgggagcgggaggcgatcgtcagcaatctgaccaag
gacgtgcaggctctgcgggaaatggtgcggagtcgggagagcgagctggtcaagctgcac
cgggaaatccacaagctgaagagtgtgctgcagcagaccaccaacaacctgaacgtcacc
cggaatgagaaggccaaaacgaagctttactccctaccagagcaatgtagcgagcaggag
gacaaggaacggaacccgcatttgtgcagctcctgcggcatggtgctgcccaccagtccg
gagttcgccctggaggcgctttcgctgggaccgctgaccccctcaacatcagcatctacc
gcctccccgtccggatcgacatctgcggaagaggtgcgacccaaggccatgcccgctgcc
atcaagaaacaaggtgtctccgccgagagctgtgtgcagtccatgcagcagtcctacagc
attcctattccaaaatacgacaaggatttcagtgataagcagcaaatcaaagacgccatc
atggacaatgacttcctgaagaatatagacgcctcgcaggtgcgggagctggtggattca
atgtactcgaagagcatagcagccggggagtttgtgatccgcgagggtgaagtgggtgca
catctgtacgtctccgccgccggggagtttgcggtgatgcagcagggcaaggtgctggac
aagatgggggcgggaaaggcgttcggggagctggctatcctctacaactgcaccaggacg
gcctccattcgagttctcagcgaggccgcgagggtatgggtgctggacagacgggtcttt
cagcagattatgatgtgcacgggtctccagcgaatcgaaaacagcgtgaacttcctgagg
tcggtgcctctgctgatgaacctgagtgaggagctgctggccaagatagcagacgttctg
gagctggagttctacgccgctggcacctacatcatccgccagggaaccgcaggggacagt
ttcttcctgatctcacagggcaatgtccgagtgacccaaaaactaacacccacctccccg
gaggagacggagctgcgcacgctctccagaggagactacttcggagagcaggcgctgatt
aacgaggataagcgaacggccaacatcatcgctctgtcaccaggagtcgagtgcttgacc
ctggacagggattccttcaagcggctgattggggatctctgcgagctgaaggagaaggac
tacggcgacgagagtaggatgctggccatgaagcacgcgcgggaaagctgccgggatgag
ccgaaggagcagctgcagcaggagttccccgacctcaagctcacggacctcgaggtggtc
agcactcttggcatcgggggcttcggtcgagtggagctggtcaaagcgcaccatcaggat
cgcgtggatatcttcgccctgaagtgcctcaagaagcgacacattgtggacaccaagcag
gaggagcacatcttcagcgaacgccacatcatgctcagctcgaggtcgcccttcatctgc
cgtttgtatcgcactttccgggacgagaagtacgtctacatgctgctcgaggcctgcatg
ggtggtgagatatggacgatgctccgggatcgcggatccttcgaggacgaggcggcgcag
ttcatcatcgggtgtgtgctgcaggcgtatgagtacctgcatgcccgcggcatcatctat
agagaccttaagcccgagaacttgatgctggatgagcgcggctacgtcaagatcgtggac
ttcggcttcgccaagcagatcggcacgagcaccaagacgtggaccttctgcggcaccccg
gagtacgtggcacccgagatcatcttgaacaagggccacgaccgagccgtggactactgg
gctttgggcattctcattcatgaactactcaacggaacgccgccgttcagtgctccagat
cccatgcagacgtacaacctcatcctgaagggcatcgacatgatagcctttcccaaacac
atctcccgctgggctgtgcagctcatcaagcggctatgccgcgatgttccgtcggagcgc
ctcggctaccagactggtggcatccaggacatcaaaaagcacaagtggttcctgggattc
gactgggacggcttggccagccagctgctgattccgcccttcgtgagacccatcgcccat
ccgacggatgtgcgctacttcgaccgctttccgtgcgatttgaatgagccgccggacgag
ctctccggctgggatgcggatttctag

DBGET integrated database retrieval system