KEGG   Drosophila erecta: Dere_GG25004Help
Entry
Dere_GG25004      CDS       T01060                                 

Definition
GG25004 gene product from transcript GG25004-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 552 aa AA seqDB search
MKAKKKLGVGLSRQERQVLVIGEIIQELLKAHEAKKDVNLNRMKSLVSSKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRSRYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLP
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLSY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKDKCSIVRELHVY
GSVVPVNARDPSKFQHQGFGMLLMEEAERISREEHGSTKLAVISGVGTRNYYRKMGYELD
GPYMSKSLEENY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgaaaaagaagttgggcgtgggattgagccgccaggaacggcaggtgctcgtc
attggcgagatcattcaggagctcctgaaggcgcacgaagccaaaaaggatgtaaacctt
aaccggatgaagtctttggtatcctcaaaatatggattggacagttccccgcgcctggtg
gacatcattgcagccgtgccgcaggacgccaaaaagatcctgcttcccaagctgagggcc
aagcccattcgcacagcaagtggcatcgccgtggtggccgtcatgtgcaagccgcatcgg
tgtccgcatatcaacatgaccggtaatatatgcgtctattgtcccggcggaccggacagc
gatttcgagtactcgacacagtcgtacacaggctatgagccgacctcgatgcgggccatc
cggtcgcggtacgatccctttcttcagacccgacaccgcgttgaacaactgaagcagctg
ggccacagcgtggacaaggtggagtttatcgtgatgggcggtacgtttatgtgcctgccg
gaggagtatcgcgactatttcatccgcaacctgcacgacgccctctccggccacagcagc
gccaatgtggcggaggccgtccgctactcggagaagtcacgcacaaagtgcattggcatc
accatagaaaccagaccggattactgcctcaagcggcacatatccgatatgcttagctat
ggttgcacccggctggaaatcggtgtgcaatcagtttacgaagacgtggccagagatacg
aaccgagggcacacagtgcgagcggtgtgcgagagcttccagctgggcaaggatgctggc
tacaagatcgtgacgcacatgatgcctgatcttccgaatgtggatttcgaacgcgacatc
gaacagttcatcgagtactttgagaaccctgccttccgctctgacggcctaaagatttat
cccacactcgtaattcgcggcacaggtctctatgagttgtggaaaactgggcggtataag
tcatatccgccatccatgcttgtagacctagtggccaaaattttggcccttgtgccacca
tggacgcgagtgtaccgtgtacagcgcgacattcccatgccgcttgttagttccggcgtg
gaacacggaaatctccgcgaactggcgctggcccgcatgaaggatcttggaaccacttgc
cgcgatgttagaacccgagaagttggcattcaggaaatccacaacaaggtgcgcccttac
gaaattgagttaatacgtcgggactatgtggccaatggaggctgggaaacgttcctctca
tacgaagatcctgaacaggacatcctcgtcggacttcttcggctgcgaaaatgttcgccg
gataccttccgcccggaattgaaggacaaatgctccattgtgagggaactgcacgtatat
ggctcagtagtgccagttaatgcgcgggatcccagcaagtttcagcaccagggcttcggt
atgttactgatggaggaggcggagcgaatttctcgagaggagcacggcagcacaaagttg
gcggtcatatcgggggtgggcaccaggaactactaccgcaaaatgggatacgagcttgac
gggccatacatgtcaaagagcttagaggaaaattactaa

DBGET integrated database retrieval system