KEGG   Dehalococcoides mccartyi 195: DET0049Help
Entry
DET0049           CDS       T00223                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DET0049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DET0049
   00052 Galactose metabolism
    DET0049
   00500 Starch and sucrose metabolism
    DET0049
   00520 Amino sugar and nucleotide sugar metabolism
    DET0049
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DET0049
   00524 Butirosin and neomycin biosynthesis
    DET0049
Enzymes [BR:det01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DET0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
40831..41841
Genome map
AA seq 336 aa AA seqDB search
MNRSNLEAILKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCARNGAEGVFENICRVLE
RLLERNNLCISQFEALSAAVAGGIDMPNGLVTQSPHLPVWRDVPLRDMLAERYLKTFLIN
DASAAALAEHKLGAGRGVKNLVYLTVSTGIGGGIIINDELYLGQSGCAGEIGHMCLDING
TEDVCGNVGCLETLASGTAIVRRVQAELAGGEFSLLSERFKADYSALTAEDIGRAASEGD
RLCQGVIRRAGEYLGIGLAGIANIFNPELIILGGGVSKLGEIFIEPARKMLFKRAFRLAG
DDVRLVASFLGDNAGVTGAALYAYGCLGGGGKPSQG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccggagtaatttagaggccatacttaagccctgtttgtgcctggatataggcggc
agtaaaatccgctcggcggtagtgacccatgacggacgggtggtggcctgggaacaggag
cctacctgcgcccggaacggggcggagggtgtatttgagaatatctgccgggtgcttgag
cgcctgcttgagcgtaacaacctttgtatctcccagtttgaggccctgtctgcggcggta
gccgggggtatagatatgccaaacggactggttacccagtctccccatctgcccgtctgg
cgggatgtaccccttcgggatatgctggcagagcgttatcttaaaacattccttataaat
gatgcctcggccgccgctttggccgaacacaaactgggagcggggcggggggttaaaaac
ctggtttacctgacggtctctaccggtatcgggggcggtattattataaatgatgagctt
tatctggggcagagcggctgtgccggtgaaatagggcatatgtgtctggatataaacggc
actgaagatgtctgcggcaatgtgggctgtctggaaacgctggcttcgggtacggctatt
gtccgcagggttcaggccgaacttgccgggggtgagttttccctgctttcagagcggttt
aaggcggattactccgctttgacggctgaggatatcggccgggcggcttccgaaggtgac
aggctgtgccagggggttatccgccgggcaggcgaatatttgggaataggtctggccggt
attgccaatatatttaaccctgagcttattatactggggggtggggtttccaaactgggg
gagatttttattgagcctgcccgcaaaatgcttttcaaacgggctttccgtctggcgggg
gatgatgtccggctggttgcttcgtttctgggggataatgccggggtgaccggggcggca
ctttatgcctacggctgcctggggggcgggggtaaaccttctcagggctga

DBGET integrated database retrieval system