KEGG   Dehalococcoides mccartyi 195: DET0049Help
Entry
DET0049           CDS       T00223                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
det  Dehalococcoides mccartyi 195
Pathway
det00010  Glycolysis / Gluconeogenesis
det00052  Galactose metabolism
det00500  Starch and sucrose metabolism
det00520  Amino sugar and nucleotide sugar metabolism
det00521  Streptomycin biosynthesis
det01100  Metabolic pathways
det01110  Biosynthesis of secondary metabolites
det01120  Microbial metabolism in diverse environments
det01130  Biosynthesis of antibiotics
det01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DET0049
   00052 Galactose metabolism
    DET0049
   00500 Starch and sucrose metabolism
    DET0049
   00520 Amino sugar and nucleotide sugar metabolism
    DET0049
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DET0049
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DET0049
Enzymes [BR:det01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DET0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N TRAF_BIRC3_bd
Motif
Other DBs
NCBI-ProteinID: AAW39098
UniProt: Q3ZAE5
Position
40831..41841
Genome map
AA seq 336 aa AA seqDB search
MNRSNLEAILKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCARNGAEGVFENICRVLE
RLLERNNLCISQFEALSAAVAGGIDMPNGLVTQSPHLPVWRDVPLRDMLAERYLKTFLIN
DASAAALAEHKLGAGRGVKNLVYLTVSTGIGGGIIINDELYLGQSGCAGEIGHMCLDING
TEDVCGNVGCLETLASGTAIVRRVQAELAGGEFSLLSERFKADYSALTAEDIGRAASEGD
RLCQGVIRRAGEYLGIGLAGIANIFNPELIILGGGVSKLGEIFIEPARKMLFKRAFRLAG
DDVRLVASFLGDNAGVTGAALYAYGCLGGGGKPSQG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccggagtaatttagaggccatacttaagccctgtttgtgcctggatataggcggc
agtaaaatccgctcggcggtagtgacccatgacggacgggtggtggcctgggaacaggag
cctacctgcgcccggaacggggcggagggtgtatttgagaatatctgccgggtgcttgag
cgcctgcttgagcgtaacaacctttgtatctcccagtttgaggccctgtctgcggcggta
gccgggggtatagatatgccaaacggactggttacccagtctccccatctgcccgtctgg
cgggatgtaccccttcgggatatgctggcagagcgttatcttaaaacattccttataaat
gatgcctcggccgccgctttggccgaacacaaactgggagcggggcggggggttaaaaac
ctggtttacctgacggtctctaccggtatcgggggcggtattattataaatgatgagctt
tatctggggcagagcggctgtgccggtgaaatagggcatatgtgtctggatataaacggc
actgaagatgtctgcggcaatgtgggctgtctggaaacgctggcttcgggtacggctatt
gtccgcagggttcaggccgaacttgccgggggtgagttttccctgctttcagagcggttt
aaggcggattactccgctttgacggctgaggatatcggccgggcggcttccgaaggtgac
aggctgtgccagggggttatccgccgggcaggcgaatatttgggaataggtctggccggt
attgccaatatatttaaccctgagcttattatactggggggtggggtttccaaactgggg
gagatttttattgagcctgcccgcaaaatgcttttcaaacgggctttccgtctggcgggg
gatgatgtccggctggttgcttcgtttctgggggataatgccggggtgaccggggcggca
ctttatgcctacggctgcctggggggcgggggtaaaccttctcagggctga

DBGET integrated database retrieval system