KEGG   Dehalococcoides mccartyi 195: DET0366Help
Entry
DET0366           CDS       T00223                                 

Gene name
pheT
Definition
phenylalanyl-tRNA synthetase subunit beta (EC:6.1.1.20)
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:det00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    DET0366 (pheT)
Enzymes [BR:det01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     DET0366 (pheT)
Amino acid related enzymes [BR:det01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   DET0366 (pheT)
Transfer RNA biogenesis [BR:det03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DET0366 (pheT)
 Prokaryotic Type
    DET0366 (pheT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
346912..349341
Genome map
AA seq 809 aa AA seqDB search
MKIPLKWLKEYLPTDMSPAELAERMTMAGTEVTVLNSRKDKWPNVYVGQIMEVNRHPNAD
RLVLVKVDWGQGQETVVTGAPNCKAGDKVVFARTGAVLIDGHNGKEMVLKPAVLRGVESC
GMVCSERELGLSDEHEGILILPADAPVGMLASEYLGEIILDLELTPNRGDLMCVTGVARE
LGALIDRLPSISTPDFKATGKDIKDKINIEIKNTKLCTRYTASLIEGIKIGESPDWLKER
LIACGMRPINNVVDATNYVMLEFGQPLHSFDYDQIKSKHIIVRPAAEGEVLTTLDGVERK
LSPDMLLITEPDKIIALAGVMGGENTEVTEKTASVLLESATFDKHSIRRTAKALKLQSEA
SARFEKGLSFELAPVALKRATQLILEIAGGQAASGLMDVMPVKKDRNSVVLSLSKVNRVL
GLEGEKFDSCKIAKRLGFAWMPEYVPGMEEFGYGSVDDKMRFFPGYWRMDIESDIDMIEE
VARIAGYDTIPCLPLDKAIPKIETPPLPGIKRFLRQILSGYGFQELISYSFTSREMLSRV
FSGAEPECLAISNPMSSEQEVMRTSLRPALYASLAANRRFEKNGLRLYELGRIYLPKENN
KQDEPEMLCALIAGSASEAWWQRNTAGFDFFDAKGIVESLVSRLGIAADFAVSDEPGLTP
GYQAGILVGDMPVGVLGQLSPQTADKFGITEPVYMFEINLSKLITRATVRRKFTQINRFP
SVERDLALVLDRSITNRQVTDIISEFDLVKNVELFDMYQGKQVAEDKKSLAYHLLFQSDT
HTLKDADVDSVMNQILKRLNTETGAVLRS
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacctttgaagtggcttaaagaatatcttcccacagatatgtcgccggccgaa
ctggccgaacggatgactatggccggtactgaggtgacagtactgaattcccgcaaagat
aaatggccgaacgtatatgtaggccagataatggaagtaaaccgtcaccccaacgctgac
cgtttggtactggttaaggtggattgggggcaggggcaggagacagtggttaccggcgcg
cctaactgcaaagccggtgacaaggtcgtttttgcccgtaccggtgcagttttgatagat
ggccacaacggcaaagaaatggtacttaagccggctgttttgcggggggtggaatcctgc
ggaatggtttgttccgaaagggaattgggactgtctgacgaacatgagggtattttgata
ctgccggctgatgctccggtgggtatgctggccagtgaatatctgggtgagataatactt
gaccttgagcttacacctaaccggggtgatttgatgtgtgtaaccggtgtggccagagaa
ctgggcgctttaatagaccgtttgccttctataagcacgccggatttcaaggccaccggt
aaggatatcaaggacaaaataaatatagagataaaaaacactaaactctgcacccgttat
accgccagcctgatagagggaataaaaatcggcgaatcaccggactggcttaaagagcgg
ctgattgcctgcggtatgcgcccgataaacaacgtggtagatgctaccaattacgttatg
ctggaattcggccagcccctgcactcctttgattatgaccagattaagtcaaaacatatt
attgtccgccccgcagcggagggtgaggttttaactactctggacggggttgaacgcaaa
ctcagcccggatatgctccttattaccgaaccggacaaaataattgccctggccggggta
atgggcggtgaaaataccgaggttactgagaaaactgccagcgtactgctggagtcggct
acctttgacaagcacagcatccgcaggactgctaaagctttgaaactccagagtgaggct
tcagcccgttttgaaaaagggcttagctttgagcttgcgcctgttgccctgaaacgcgcc
acccagctgatactggaaatagccggcgggcaggcggcttcgggcttaatggatgtcatg
ccggttaaaaaagacagaaacagcgttgtattatctctttcaaaggtcaaccgggtatta
gggcttgagggagagaaatttgacagctgtaaaatagccaaaaggctgggttttgcctgg
atgcccgaatatgtacccggtatggaagaattcggctacggttccgttgatgataaaatg
cggtttttccccggttactggcggatggatattgaaagtgatattgatatgattgaggag
gtggccaggatagccggctacgatactataccctgtctgcctctggataaagccattcct
aaaatagaaacaccccctctgccgggcataaagcgtttcttacggcagatattatcaggg
tatggttttcaggaacttatatcatattcattcaccagccgcgaaatgctttcccgtgtt
ttttcaggggctgagcccgaatgtctggctatcagcaaccccatgagcagtgagcaggaa
gttatgcgtaccagcttgcgtcctgccctgtatgcatctttagcggcaaaccgccgtttt
gaaaaaaacggcctcaggctgtatgagcttgggcgcatctacctgccgaaagagaataat
aagcaagatgagcccgaaatgctgtgcgcccttatagcgggcagtgcctctgaagcctgg
tggcagagaaataccgctggttttgacttctttgatgccaaaggcattgtggaatctttg
gtcagccggttgggtattgcagctgattttgcggtatctgatgaaccgggtctgactccg
gggtatcaggccggtatactggtgggagacatgccggtgggtgttttggggcagctaagc
ccccagactgcagataaattcggcataacagagccggtatatatgtttgaaatcaatctt
tccaagctcattacccgggctacggttcggcgcaaatttacccagattaaccgcttcccc
tcagtggaacgtgatttggctttggtgcttgaccgcagtattaccaaccggcaggttaca
gatataatttccgagtttgatttggttaaaaatgtagagctgtttgatatgtatcagggc
aagcaggtagccgaggacaaaaaatcactggcttatcatctgctgtttcagtctgatacc
cataccctgaaagatgcggatgtagacagtgtaatgaaccagatacttaaacggcttaat
actgaaacgggggcggttctgcgttcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system