KEGG   Dehalococcoides mccartyi 195: DET0405Help
Entry
DET0405           CDS       T00223                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DET0405 (ispE)
Enzymes [BR:det01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DET0405 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
383746..384600
Genome map
AA seq 284 aa AA seqDB search
MLTLLAPAKVNLSLEVLYRRNDGYHELRSIIQSLSLCDRLSFSPAKTVQISSDSPDWQAE
HSLVSKAVALFSEKCGQGRGVNLTIAKRIPLVSGLGGDSSCAAAVLKGLNKLWGCGYPRW
RLMELGAELGSDVPFFMMGGTAMMEGRGETVTPLPTLNQMWAVLLVPEIEMPPDKTAALY
RNLHADSFSSGEISDKLLEDICQGKLSYSSCFNVFEKIAFTLFPDLAKYRWQFLEAGAYQ
IFLAGAGPTLFTLLKDKNMAEKIYHNLCQKGHQAYLVSTLGPLD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctgacactgctggctccggccaaagtcaaccttagtctggaagtcctctaccgccgg
aatgacgggtaccatgagctgcggagtattattcagtcactcagcttatgtgaccgcctg
tctttcagcccggccaaaacagtgcaaataagctcagacagcccggattggcaggctgaa
catagcttggtttccaaagctgtggccttatttagtgaaaagtgcgggcagggacgcggg
gtaaacctgactatagccaagcgtattcccctggtttcggggttggggggagacagttcc
tgtgcggcggctgttttaaaagggcttaacaagctgtgggggtgcggttatccgcgctgg
cggcttatggaactgggggcagagctgggttctgacgtgccgtttttcatgatgggcggt
acggctatgatggaaggacgtggagaaaccgtaacccccctgcccactctcaatcaaatg
tgggcggttttgctggttcctgaaatagaaatgccgccggataaaactgccgctctctac
cgtaatctgcatgcagatagctttagcagcggggaaataagcgataaactgctggaagat
atatgtcagggtaagctaagctacagttcgtgtttcaatgtatttgaaaaaatagccttc
acccttttccctgatttggccaaataccgctggcaatttctggaagccggggcttaccag
atatttttagccggagcaggcccgaccctctttaccctgcttaaagataaaaatatggct
gagaagatataccataatctgtgccagaaggggcatcaggcttatctggtatccacttta
gggccactggattga

DBGET integrated database retrieval system