KEGG   Dehalococcoides mccartyi 195: DET0612Help
Entry
DET0612           CDS       T00223                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
det  Dehalococcoides mccartyi 195
Brite
Enzymes [BR:det01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DET0612
Transfer RNA biogenesis [BR:det03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    DET0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
566373..567752
Genome map
AA seq 459 aa AA seqDB search
MKKLSRTISGVTPVAVMTKPLPCPGKCVYCPTFEATPQSYTPESPAVLRAKSCEYQAYRQ
VALRLRIIQDMGHPTDKVELIIMGGTFLAADTAYQYGFIKDCYDALNGVVASSLEEAKAI
NETAQHRCVGLCIETRPDICGEAEIQRMIDFGTTRVELGVQMLDDDIYKLVERGHTVADV
AESTRLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVFEDPRFCPDGLKLYPTMVVEGTI
LEEWWKEGRYTPYPSDIMTGLIADIKALVPPYVRISRVLRDIPAVFIRAGLKDSLRDGVR
QILESRNQKCKCIRCREYGHRQRKGQTSGEPALKRLDYQASGGKEIFLSFEDASDTLYGL
LRLRIPQVSLPVLDKKYGGKTGLVRELHVYGTELSLGEQGEQSAQHRGLGRKLVAEAERL
VRDEYGLSSLAILSGVGAREYYRSLGYELVAGYMCKYLG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctttcccgaacaatatcaggcgttactccggtggcggttatgaccaagcct
ttgccctgccccggcaaatgcgtatactgccccacctttgaggctactccccagagctat
acgcctgaatctccggctgttttgcgggccaaaagctgtgaataccaggcgtaccggcag
gttgcccttcgcctgcggataatacaggatatgggtcaccccactgataaggttgagctt
ataatcatggggggtacttttcttgcggcagatactgcctaccagtatggttttattaaa
gactgttatgatgctttgaacggggtagtggcctccagtttagaggaagccaaggctata
aatgaaaccgcccagcaccgctgcgtgggtttatgcattgaaacccgcccggatatctgc
ggtgaggccgaaatacagcggatgatagattttggtactaccagagtggaacttggcgtc
cagatgctggatgatgatatttataaactggttgaacgggggcatacagtggcagatgtg
gctgagtccacccgccttttgcgtgaatacggccttaaggttcattaccactggatgccc
ggacttcccggctcttctcctgaaaaagatttagctctttcccgtatggtgtttgaagac
ccgcgtttctgtcctgacgggcttaagctttatcccactatggtagtggagggtactata
cttgaagagtggtggaaagaaggccgctataccccgtacccgagtgatattatgaccggg
ctaattgcggatattaaagctctggtgccgccttatgtgcgtatttcgcgggtgcttcgg
gatataccggctgtatttatccgtgccggtctcaaagactcactgcgggatggagtgcgg
cagatactggaaagccgtaaccagaagtgcaagtgtatacgctgccgcgagtatggtcac
cgccagcgcaagggtcagaccagcggtgagcctgccttaaaacgtctggattatcaggca
tcaggcggcaaggagatattccttagttttgaagatgcctctgataccctttacggcctg
ctcaggctgcgcataccgcaggtttctctgccggtacttgataaaaaatatggcggtaaa
acagggctggtgcgtgaactgcacgtatacggcacagaactttcactgggtgaacagggc
gaacagtctgcccagcaccggggtcttggcagaaagctggtagcagaggcagagcgtctg
gtgcgggacgaatatggccttagctcacttgccattctaagcggggtgggtgccagagag
tattaccgctcacttgggtatgagcttgtggctggttatatgtgtaagtatttgggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system