KEGG   Dehalococcoides mccartyi 195: DET0724Help
Entry
DET0724           CDS       T00223                                 

Gene name
porG
Definition
(GenBank) pyruvic-ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
det  Dehalococcoides mccartyi 195
Pathway
det00010  Glycolysis / Gluconeogenesis
det00020  Citrate cycle (TCA cycle)
det00620  Pyruvate metabolism
det00633  Nitrotoluene degradation
det00640  Propanoate metabolism
det00650  Butanoate metabolism
det00680  Methane metabolism
det01100  Metabolic pathways
det01120  Microbial metabolism in diverse environments
det01130  Biosynthesis of antibiotics
det01200  Carbon metabolism
Module
det_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DET0724 (porG)
   00020 Citrate cycle (TCA cycle)
    DET0724 (porG)
   00620 Pyruvate metabolism
    DET0724 (porG)
   00640 Propanoate metabolism
    DET0724 (porG)
   00650 Butanoate metabolism
    DET0724 (porG)
  Energy metabolism
   00680 Methane metabolism
    DET0724 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DET0724 (porG)
Enzymes [BR:det01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DET0724 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AAW40022
UniProt: Q3Z8I7
Position
668313..668885
Genome map
AA seq 190 aa AA seqDB search
MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDDK
PIRERSGISEPDIVVVLDPSLVIIGNVISGLKEGGTLIINTTKPLDYFVSEYGDRWKIAT
VDATAIAKELLGVNIVNTTMLGALIKATGLAGIEDFEEPLKHRFGKLAAKNMAAMKKALE
ETAVKELKVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttattgaaatcagatggcatgggcgtggcggtcagggtgcggtaacctca
gccgagcttatcgctcaggcggcaattggcaagggaaaatatgcccaggctttccccagt
ttcgggcctgaacgcagaggagctccggttcaatctttcaaccgtatcagtgatgataaa
cctatccgtgagcgttccggtataagcgagccggatattgtggtagtacttgaccccagt
ctggttattatcggcaacgttatttccgggcttaaagaaggcggtactcttattataaat
accactaaaccgctggattatttcgtatctgaatatggtgaccgctggaaaatagccaca
gtggatgccaccgctattgccaaagaattactgggtgtcaatatcgttaatacaaccatg
cttggcgctcttatcaaggctaccggtctggcaggtatagaagacttcgaagaacctttg
aaacaccgcttcggaaagctggctgccaaaaatatggcggctatgaaaaaggccttggaa
gagaccgctgtaaaggagcttaaagttggctaa

DBGET integrated database retrieval system