KEGG   Dehalococcoides mccartyi 195: DET0725Help
Entry
DET0725           CDS       T00223                                 

Gene name
porD
Definition
pyruvic-ferredoxin oxidoreductase, delta subunit (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DET0725 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DET0725 (porD)
   00020 Citrate cycle (TCA cycle)
    DET0725 (porD)
   00620 Pyruvate metabolism
    DET0725 (porD)
   00640 Propanoate metabolism
    DET0725 (porD)
   00650 Butanoate metabolism
    DET0725 (porD)
  Energy metabolism
   00680 Methane metabolism
    DET0725 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DET0725 (porD)
Enzymes [BR:det01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DET0725 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
668914..669174
Genome map
AA seq 86 aa AA seqDB search
MTPGCIVSEPGNASQYKTGDWRSQLPVHNFKKCIKCGLCYVFCPEACINETKEGFFEADL
FYCKGCGICAHECPTGAIVMKDEEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgacccctggctgtatagtcagtgaacccggaaatgccagtcagtataagactggtgac
tggcgttcccagctgcctgtgcataattttaaaaaatgtatcaagtgcggcttgtgttat
gtattctgccccgaagcttgtataaatgaaaccaaagagggcttttttgaggccgacctt
ttctattgtaagggttgcggtatctgcgcccatgaatgtcccaccggggctattgttatg
aaggatgaggaggagaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system