KEGG   Dehalococcoides mccartyi 195: DET0727Help
Entry
DET0727           CDS       T00223                                 

Gene name
porB
Definition
pyruvic-ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DET0727 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DET0727 (porB)
   00020 Citrate cycle (TCA cycle)
    DET0727 (porB)
   00620 Pyruvate metabolism
    DET0727 (porB)
   00640 Propanoate metabolism
    DET0727 (porB)
   00650 Butanoate metabolism
    DET0727 (porB)
  Energy metabolism
   00680 Methane metabolism
    DET0727 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DET0727 (porB)
Enzymes [BR:det01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DET0727 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
670346..671287
Genome map
AA seq 313 aa AA seqDB search
MQNYSVFVPKLLPKRELFAPGHRGCIGCGEALAVRLATKAMDENTIIVNATGCMEIIASQ
YPYTSWRLPWIHTLFENTAAVASGVESAIKVLKRKKRIEDRDIKIVAIGGDGATVDIGLQ
ALSGAMERGHNFTYICFDNEAYMNTGIQRSSATPFGASTTTSPAGKVGKGQFSWKKDMPA
IAVAHNIPYVATCCPSYPFDMIEKVGKALAADGPAYIHCLSVCPTGWRCATEDTVKIGRL
AVETGVFPLYEVVNGQYKMSMETPELKPLREYTSLQRRFRHLTEESLDLIQERVQLEYNK
IAERAACAPKLEK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactattcagtatttgttcccaagctactgcccaagcgtgagttatttgccccc
ggtcatcgcgggtgtataggttgcggtgaggctctggcagttcgtctggctaccaaggct
atggatgaaaacaccataatagtgaatgccaccggctgcatggaaattatcgcttcccag
tacccgtatacctcatggcgtttaccctggatacataccctgtttgaaaatacagccgca
gttgcctctggcgttgagtcagctataaaggtgcttaaacggaaaaagaggatagaggac
agggatataaagattgtagccattggcggtgacggtgcaactgtggatattggtcttcag
gcactttcaggcgctatggaacgcgggcataacttcacttatatctgttttgacaatgaa
gcttatatgaataccggtatccagcgttcctcggctacccctttcggtgcgtccaccact
acctcaccggccggtaaagtaggcaaaggccagttctcatggaaaaaagatatgccggcc
atagctgtggcccataatattccttatgtggctacctgttgccctagctatccttttgat
atgattgaaaaagtaggtaaggccctggcggctgacggtccggcctatatacactgttta
tctgtttgtcccaccggctggcgctgtgccactgaagataccgtgaagatagggcgtttg
gcagttgaaaccggtgttttcccgctgtatgaggttgttaacggccagtacaaaatgagc
atggaaacgcctgagcttaagcctttgcgtgagtacaccagtcttcagcggcggttccgc
cacctgacagaagaatctctggaccttattcaggaaagagttcagctggaatacaataag
attgcagagagggcggcatgtgcaccgaaactagagaaatag

DBGET integrated database retrieval system