KEGG   Dehalococcoides mccartyi 195: DET0742Help
Entry
DET0742           CDS       T00223                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DET0742 (tpiA)
   01230 Biosynthesis of amino acids
    DET0742 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DET0742 (tpiA)
   00051 Fructose and mannose metabolism
    DET0742 (tpiA)
   00562 Inositol phosphate metabolism
    DET0742 (tpiA)
Enzymes [BR:det01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DET0742 (tpiA)
Exosome [BR:det04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DET0742 (tpiA)
  Exosomal proteins of bladder cancer cells
   DET0742 (tpiA)
  Exosomal proteins of melanoma cells
   DET0742 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(683187..683942)
Genome map
AA seq 251 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACTLVQGMKYELDQISGIQKIVCPPFISLAPVKTILDGSSIH
LGAQNLFYEEKGAYTGEISPLMLQDICPYVIIGHSERRAYFGETGQVVNRKIKAALQAGI
MPIVCVGEKLEENENGQTRQILETQMKEALAGINPSSIIIAYEPIWAIGTGKAATAAEAN
NTISYIRKVLGDIWGNTASRITPILYGGSVNEKNTAELLCQSDIDGALVGGASLKAESFV
SICRQAADVRK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagacagattattattgccgggaactggaaaatgaataccactctttccgaagcttgt
acactagtgcaaggcatgaaatatgaacttgaccaaataagcggcattcagaaaatagtc
tgcccgccgtttatatctttagccccggtaaaaaccatactggacggcagcagtatccat
ttgggtgctcaaaaccttttctacgaagaaaaaggggcttacaccggagaaatttccccc
ctgatgctgcaagatatctgcccatatgtgattataggccactctgaaaggcgggcctat
ttcggcgagaccggacaagtagttaaccggaagataaaagccgcccttcaggcaggtata
atgccaatagtgtgcgtgggcgaaaaactggaagagaatgaaaacggccagacccgccaa
atactggaaacccagatgaaagaggctttagccgggattaacccaagcagtatcataata
gcctatgagcctatctgggccataggcacaggcaaggctgccactgcagcggaagccaat
aacactataagttatatccgcaaggtattgggtgatatatggggcaataccgcatcccgg
attacgcctattctatatggcggcagcgtaaatgaaaaaaatactgccgaacttctttgc
cagtcagatatagacggagctttggtaggcggagcttccctgaaagcagagtcttttgtc
agcatatgccgccaggctgctgatgtaagaaaataa

DBGET integrated database retrieval system