KEGG   Dehalococcoides ethenogenes: DET1114Help
Entry
DET1114           CDS       T00223                                 

Definition
type III restriction-modification system, restriction endonuclease subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
det  Dehalococcoides ethenogenes
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1018023..1021082
Genome map
AA seq 1019 aa AA seqDB search
MRIQYKHQKFQADAAKAVVDVFAGQPYLTPTYMMDRGTGMFQIGLNEERDYTGWSNQKIV
PELSDHLILEHIQKIQRTNQIQPSSKLEGRSDGFNLTIEMETGVGKTYTYIKTMYELNRA
YGWSKFIIVVPSIAIREGVYKSFQMTQEHFAEEYGKKIRFFIYNSAQLTEIDRFASDSSI
NVMIINSQAFNAKGKDARRIYMKLDEFRSRRPIDIIAKTNPILIIDEPQSVEGKQTKERL
KEFQPLLTLRYSATHKSDSIYNMIYRLDAMEAYNKRLVKKIAVKGITETGSTATDSYLYL
EGLNLSKGDPTATLQFEVKMASGTPKKKSRVVKIGDNLYDYSGGLEEYKNGFVVKQIDGR
DDSVEFLNGIKIYAGDVMGAVDEDQLRRIQIRETILSHIQRERQLFYKGIKVLSLFFIDE
VANYREYDAAGQPVNGKYARMFEEEYEDIISNMQLSIGEDEYIKYLQSIKASKTHAGYFS
VDGKGKMINSKVGRKETTSDDVSAYELIMKNKELLLDRDPKKSPVRFIFSHSALREGWDN
PNVFQICTLKQSSSDVRKRQEVGRGLRLCVNQDGERMDTNALGNDVHNVNVLTVIASESY
DSFAKGLQTEMADAVADRPRAVTIDLFVGKVIKDDKGNEQVIDQDTASAIHYDMIVNGYI
DRKGVLTDKYYEDKANGEIKVAEEVADSAASVIEIVDSIYDARSMQPENARSNNVELQVD
EEKLAMPEFKALWSKINAKSVYVVDFDTDELIRKSIASLDAKLRVSKIYFRVESGAMDNI
KSKEELVSGASFVKEESASYGVTITANSNVKYDLIGKLVDETGLTRKAVIAILQGIKPFV
FDQFKDNPEEFIVKAAALINDEKATAIIEHITYDVLDEHYGMDVFTDPTIKGKLGVNAMK
AKKHLYDHIVYDSSNERDFATDLDTNTDVAVYVKLPDGFYISTPVGHYNPDWAIAFYEGK
VKHIYFVAETKGSMSSMQLRLIEESKIHCAREHFKAISNGNVVYDVVDSYKSLLEKVMK
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgagaattcaatacaaacatcaaaaattccaagctgatgctgccaaggcggtcgtggat
gtttttgcaggccagccttatctgacgcctacctatatgatggatagaggaaccggtatg
tttcagattggattgaatgaggaacgtgattataccggttggagtaaccagaagattgtg
ccggagctttccgatcatctgattctggagcatatacagaaaattcagcgtacaaatcaa
atccagccgtcttccaagctggaaggccgcagcgacggtttcaatctcaccatcgagatg
gagaccggtgttggcaagacttatacctatatcaagacaatgtatgagctgaaccgcgcc
tatggctggagtaagttcatcattgtggttccgagtatcgctatacgtgagggcgtgtat
aagtccttccagatgacgcaagagcatttcgcagaagagtacggaaaaaagatccgcttc
tttatctataattctgcacagctcacggagattgaccgctttgcttcggatagctctatt
aatgtcatgatcatcaattcgcaggcgttcaatgccaagggcaaggatgcaaggcgtatt
tacatgaagctggacgagttccgcagccgtcgcccgattgacatcattgcgaagacgaat
ccgattctgatcatcgacgagccacagtctgtggaaggtaagcagacaaaggagcgcctg
aaggaattccagccgctgctgacgctgcgttattccgctacgcataagtcagacagcatt
tacaatatgatatatcggctggacgctatggaagcatataacaagcgtctggttaagaag
atcgccgttaagggtatcaccgagaccggcagcacggccacggacagctatctctatctg
gaaggtctgaatctttccaagggtgatcctactgctacgctgcagtttgaggtcaagatg
gccagtggcactccaaagaaaaagagccgcgttgtgaaaatcggagataatctctacgac
tattccggcgggctggaagaatacaaaaacggctttgtggtcaagcagatcgatggccgg
gacgactccgtggaattcctgaacggcatcaagatttatgccggtgacgtgatgggcgcg
gtcgatgaagaccagctgcgccgtattcagatcagagagacaatcttgtcgcatattcag
agagaacgtcagctcttctataagggcatcaaggtgttgtccctgttctttattgacgag
gttgcaaactacagagagtatgatgctgcaggtcagccggtaaatggaaagtacgccaga
atgtttgaagaggagtacgaggacatcatcagcaatatgcagcttagtataggcgaggat
gaatacatcaaatacctgcagagcatcaaggcttctaagacgcatgcgggatatttctca
gtggacggaaaaggcaagatgatcaattccaaggtcggtcgtaaagaaacgacctcagac
gatgtgagcgcctatgagctgattatgaagaacaaggagctgcttcttgatcgtgatccg
aagaagtctccggtgcgcttcatcttttcacactccgctctgcgtgaaggatgggacaat
cctaatgtgttccagatctgtacgctgaagcagtccagcagtgatgttcgtaagcgtcag
gaagtaggccgtggcctgcgtctttgcgtcaatcaggacggtgagcgtatggataccaat
gcgctcggaaatgacgttcataacgtgaatgttctgacggttattgccagcgagagctac
gattcctttgccaaaggcctgcagaccgagatggctgacgccgttgctgatagaccgcgt
gcggttaccatcgatctctttgtcggaaaagtaatcaaggacgacaagggtaatgagcag
gttatcgatcaggatactgcttccgcaatccactacgatatgatcgttaacggttatatc
gaccgtaagggcgttctgacagataagtattacgaggataaggcaaacggagaaatcaag
gtcgcagaggaagtggctgattccgcagcctctgttattgagattgttgactccatttac
gatgctcgtagcatgcagcctgagaatgcccgcagcaataacgtcgagcttcaggtcgat
gaagagaaactggctatgccggaattcaaagcgctgtggtcaaagatcaatgctaagtcc
gtatatgttgttgattttgataccgacgagctgatcaggaagtccatcgcctcccttgat
gccaagctgcgtgtatcgaagatttacttccgcgtagagtccggtgcaatggataacatc
aagtcgaaggaagagcttgtatccggagcctccttcgtaaaagaagagtccgccagctac
ggtgtgaccatcacagcgaactcgaatgtaaagtatgacctgattgggaaactggtggac
gagaccgggcttacccgtaaggcggtcattgcaatccttcagggaatcaagccgtttgtg
ttcgaccagtttaaggataatccggaggagtttatcgtcaaggccgccgcgctgatcaat
gacgagaaagccacggccattatcgagcacattacctacgacgttctggatgagcattat
ggcatggatgttttcaccgatcccaccatcaagggcaagctgggcgttaatgcgatgaag
gcaaagaagcacctgtacgatcacatcgtttacgattcatcgaacgagcgcgactttgct
acagaccttgatacaaacaccgatgttgcggtttacgtgaagctgccggatggattctat
atttccactcctgtcggccactacaatcccgactgggcaattgccttctacgagggcaag
gtaaagcacatatacttcgtggcagagacgaagggctccatgagctcgatgcagctgcgg
ctgattgaggagtccaagattcactgcgcgagagaacactttaaggccatttccaatggg
aatgtggtatacgacgtagtcgatagctataagtccctattggagaaggtaatgaaataa

DBGET integrated database retrieval system