KEGG   Dehalococcoides mccartyi 195: DET1205Help
Entry
DET1205           CDS       T00223                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
det  Dehalococcoides mccartyi 195
Pathway
det00260  Glycine, serine and threonine metabolism
det00750  Vitamin B6 metabolism
det01100  Metabolic pathways
det01110  Biosynthesis of secondary metabolites
det01120  Microbial metabolism in diverse environments
det01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DET1205 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DET1205 (thrC)
Enzymes [BR:det01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DET1205 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAW39541
UniProt: Q3Z781
Position
complement(1102269..1103315)
Genome map
AA seq 348 aa AA seqDB search
MKQGVIEHYRKYLPVTDKTPPLTLGEGDTPLVRCPKLEKELGIAELYFKLEGCNPTGSFK
DRGMVMAVAKAIEDGFKAVVCASTGNTSASATAYAAASGLESIIIIPSGKIALGKLAQAI
VYGAKIIQIKGNFDQALQIVFKLTEKHKVALVNSVNPYRIEGQKTSAFEIVDALGKAPDF
LFIPVGNAGNITAYWKGFKEYHQLGKAASLPKMMGFQAEGAAPIVRGHAIAEPETLATAI
RIGNPASWKKAEEARDQSGGIIDMVSDAEIMAAYHKMASAGIFGEPASAAPLAGLIKRIK
GGQDFSSSQVVCVVTGNGLKDSNIAIKGAGGFSETEASLGAVEKVLGW
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagggtgtcattgagcattaccggaaatatctgccggttacagataaaaccccc
ccgcttacgctgggtgagggtgatacgcctctggtgcgttgcccaaagctggaaaaggaa
ctggggatagctgagctttattttaagctggaaggctgcaatcccaccggctctttcaag
gaccggggcatggtcatggcggttgccaaggctattgaagatggttttaaagcggtggtt
tgtgcttccaccggcaataccagcgcttcggctaccgcctatgcggctgccagcgggctt
gagtccattataattatcccgtccggcaaaatagccctgggcaaactggctcaggcaatt
gtttacggggcaaaaatcattcagattaaaggcaactttgaccaagccttgcagatagtc
ttcaaactgactgagaagcacaaagtggcgctggttaactcggttaatccataccgtata
gaaggccagaaaacatctgcttttgagattgtagacgctctgggcaaagcgcctgacttt
ttgtttataccggtgggcaatgccggcaatattactgcctattggaagggttttaaagaa
tatcaccagctgggtaaagccgcttccctgcccaaaatgatgggttttcaggccgaaggg
gccgcccccattgtccgcggccatgctattgccgagcctgaaacactggccaccgctatc
cgcataggtaaccctgcttcctggaaaaaagccgaggaagccagagaccagtcaggcggg
attatagacatggtttcagatgccgaaataatggccgcttatcacaaaatggcatcagcc
ggcattttcggtgagccggcctcggccgcacccttggctgggctgataaaacgtattaag
ggcgggcaggatttttcctcaagccaggttgtatgtgtggttaccggaaacggccttaag
gacagcaatattgccataaaaggggcgggcggtttttccgaaaccgaagccagccttggg
gcagttgaaaaagtactgggctggtag

DBGET integrated database retrieval system