KEGG   Dehalococcoides mccartyi 195: DET1225Help
Entry
DET1225           CDS       T00223                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DET1225
   01230 Biosynthesis of amino acids
    DET1225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DET1225
   00030 Pentose phosphate pathway
    DET1225
   00051 Fructose and mannose metabolism
    DET1225
  Energy metabolism
   00680 Methane metabolism
    DET1225
Enzymes [BR:det01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DET1225
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DET1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1123871..1124968
Genome map
AA seq 365 aa AA seqDB search
MKVTLSVIKADIGGFVGHSDSHPQCLVRAEKHLAEAKKNGMLIDYHITKCGDDLQLVMTH
QKGINNKVIHEMAWDTFVSCTEVAKELKLYGAGQDLLCDAFSGNVKGMGPGVAEMELEER
PSEPIIIFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHDGFSFEVHDVKESKGISF
NTPEEIYDMLVFIGAHSRFAIKSVSTRKGEIAAVSSTQKLAFLADRYVGKDDPVCIVRAQ
GSFPAVGEILEPFAQPYLVEGWMRGSHNGPIMPVSIEDSTPTRFDGPPRVTALGFQLSNG
MLIGPRDMFKDKSFDNARQKSLDMADMMRSHGPFEPHRLPLEEMEYTTMPQVSKKLAGRF
KPLED
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaacccttagtgttattaaagcagatatcggcggttttgtaggccattcggac
tcacacccgcagtgtctggtcagggctgaaaagcacctggcggaggccaaaaagaatggc
atgctgattgattaccatataactaagtgcggtgacgacctccagctggttatgacccac
cagaaaggtataaacaacaaagttattcacgaaatggcctgggatacctttgtaagctgc
accgaagttgccaaagagctgaagctttacggcgcagggcaggacttgctgtgtgatgcc
ttctccggaaacgtaaagggcatggggcccggcgtagccgaaatggagcttgaggaacgg
ccttccgaacctatcataatcttcatggccgacaagacctcttccggtgcctggaatctg
cctctttacaaaatgtttgcagacccctttaacaccataggtttggtcatagctgaaaat
atgcatgacggcttctcctttgaggttcatgacgtcaaggaaagcaagggcattagcttt
aacacccccgaagaaatttatgacatgctggtatttatcggcgctcattcccgcttcgct
atcaagagtgtttccacccgcaagggcgagattgcggctgtttcttccacccagaaactg
gcctttttagctgaccgttatgtaggtaaagacgacccggtttgtattgtccgcgctcag
gggtctttcccggctgtgggtgaaatacttgaacccttcgcccagccttatctggtagaa
ggctggatgcgcggctcgcacaacggccctattatgcctgtctcaatagaagacagcacc
cccacccgctttgacggcccgccccgggtaaccgctctgggtttccagctgtcaaacggt
atgcttatcggcccgcgtgatatgtttaaagataagtcttttgacaatgcccgccagaaa
tcactggatatggcagatatgatgcgctcccacggcccgtttgagccccatcgcctgccg
ctggaggaaatggaatacaccaccatgcctcaggtatccaagaaactggccggacgcttt
aaacccctggaagactag

DBGET integrated database retrieval system