KEGG   Dehalococcoides mccartyi 195: DET1346Help
Entry
DET1346           CDS       T00223                                 

Definition
carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DET1346
   01230 Biosynthesis of amino acids
    DET1346
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DET1346
   00030 Pentose phosphate pathway
    DET1346
   00051 Fructose and mannose metabolism
    DET1346
   00052 Galactose metabolism
    DET1346
  Energy metabolism
   00680 Methane metabolism
    DET1346
Enzymes [BR:det01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DET1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1216894..1217826
Genome map
AA seq 310 aa AA seqDB search
MITTVTLNPCLDKHIDVHGLVLYETNRWHLMSKYAGGKGIDVSRAIHEMGNDTIACGFLG
SEEGREIETLLAKQGLKYRFTPISQPTRSCFIIYDTKTRRQTNLNAPGPRITPSELKLFH
EDLHRESASSNIIVMSGSVPPGIPSNVYFTLIKSAHKLGKQTILDTTGKYLRAGLKAKPC
LVKPNIREAEELLGRKLETEAEIILGAKEIVQMGAGIAVISMGKKGLIASDGKQVIKASS
PYVRVKSAVGAGDSTVAGLAISLCRGDSLEEACRLGVAMGTAAVMTPGTELCHREDVLYW
LPRIKIRRLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattaccaccgttaccctaaacccctgtctggacaaacacatagacgtgcatggtctg
gtactgtacgaaactaaccgctggcatcttatgtccaaatatgccggcggcaaaggcata
gatgtgtcacgggcgatacatgaaatgggaaatgataccattgcctgcggttttctgggc
agtgaagagggacgggagatagaaaccctgcttgcaaaacaggggcttaaataccgcttc
actcccataagccagcctacccgaagctgttttataatatacgacactaaaacccgccgc
cagactaatcttaacgcccccggcccgcggataacgccgtctgaactgaaactttttcac
gaagacctgcacagggaaagcgcttcgtcaaacattattgttatgtcaggcagcgtaccg
ccgggaataccttcaaacgtctatttcacccttatcaagagcgcccataaactgggcaag
caaaccatactggataccaccggcaaatacctgcgggcagggcttaaggctaaaccctgt
ctggtaaagcctaatatccgcgaagcggaagagctgctgggcaggaaactggaaaccgag
gctgaaataatactgggggctaaggaaatagtccaaatgggagcgggcatagcggtaatc
tccatgggcaaaaaggggctgatagccagtgacggcaagcaggttataaaagccagctct
ccctatgtgcgggtaaaaagcgcggtgggggcgggtgattcaacggtggccggcttggcc
atatccctttgccgaggggacagtctggaagaagcctgccgtttaggtgtagccatgggg
acagccgccgtgatgacgccgggcaccgaactctgccaccgcgaagacgttttgtactgg
ctgccccgcattaaaatccgccgtttagcttag

DBGET integrated database retrieval system