KEGG   Dehalococcoides ethenogenes: DET1346Help
Entry
DET1346           CDS       T00223                                 

Definition
carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
det  Dehalococcoides ethenogenes
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:det01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:det01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:det00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:det00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:det00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:det00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:det00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1216894..1217826
Genome map
AA seq 310 aa AA seqDB search
MITTVTLNPCLDKHIDVHGLVLYETNRWHLMSKYAGGKGIDVSRAIHEMGNDTIACGFLG
SEEGREIETLLAKQGLKYRFTPISQPTRSCFIIYDTKTRRQTNLNAPGPRITPSELKLFH
EDLHRESASSNIIVMSGSVPPGIPSNVYFTLIKSAHKLGKQTILDTTGKYLRAGLKAKPC
LVKPNIREAEELLGRKLETEAEIILGAKEIVQMGAGIAVISMGKKGLIASDGKQVIKASS
PYVRVKSAVGAGDSTVAGLAISLCRGDSLEEACRLGVAMGTAAVMTPGTELCHREDVLYW
LPRIKIRRLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattaccaccgttaccctaaacccctgtctggacaaacacatagacgtgcatggtctg
gtactgtacgaaactaaccgctggcatcttatgtccaaatatgccggcggcaaaggcata
gatgtgtcacgggcgatacatgaaatgggaaatgataccattgcctgcggttttctgggc
agtgaagagggacgggagatagaaaccctgcttgcaaaacaggggcttaaataccgcttc
actcccataagccagcctacccgaagctgttttataatatacgacactaaaacccgccgc
cagactaatcttaacgcccccggcccgcggataacgccgtctgaactgaaactttttcac
gaagacctgcacagggaaagcgcttcgtcaaacattattgttatgtcaggcagcgtaccg
ccgggaataccttcaaacgtctatttcacccttatcaagagcgcccataaactgggcaag
caaaccatactggataccaccggcaaatacctgcgggcagggcttaaggctaaaccctgt
ctggtaaagcctaatatccgcgaagcggaagagctgctgggcaggaaactggaaaccgag
gctgaaataatactgggggctaaggaaatagtccaaatgggagcgggcatagcggtaatc
tccatgggcaaaaaggggctgatagccagtgacggcaagcaggttataaaagccagctct
ccctatgtgcgggtaaaaagcgcggtgggggcgggtgattcaacggtggccggcttggcc
atatccctttgccgaggggacagtctggaagaagcctgccgtttaggtgtagccatgggg
acagccgccgtgatgacgccgggcaccgaactctgccaccgcgaagacgttttgtactgg
ctgccccgcattaaaatccgccgtttagcttag

DBGET integrated database retrieval system