KEGG   Dehalococcoides mccartyi 195: DET1487Help
Entry
DET1487           CDS       T00223                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DET1487 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DET1487 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DET1487 (trpB)
Enzymes [BR:det01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DET1487 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1344698..1345897
Genome map
AA seq 399 aa AA seqDB search
MPKVDSTGKPGYFGKYGGQFVPEILVPVLNELEQAYEQAKKDETFQSRLKSLSNTFSGRP
TPLYLAERLTEHLGGARIYLKREDLAHTGAHKINNALGQGLLALHMGKKRVIAETGAGQH
GVATAAVCAMLGLECIVYMGEDDIKRQALNVFRMKLMGTEVRSVSSGSRTLKDAINEAMR
DWVSNPETTYYIIGSVVGPRPYPAMVRDFQAVIGQETKAQSLRQLGGLPDCIVACVGGGS
NAMGIFYDFIPDQSVRLIGVEAAGSGISTGKHSATLSAGKVGILHGAMSYLLQDEHGQVI
ETHSISAGLDYPGVGPEHSYLKDNKRVEYVSVTDEEALNGFKLLCSLEGIMPALESSHAI
AHALKIAVGMPKNKNIVINLSGRGDKDMDIVQKAMGVKI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagtagatagcaccggtaaaccggggtatttcggcaagtatggcgggcagttt
gtacctgaaatactggtgccagtcctaaacgaactggaacaggcttatgaacaagccaaa
aaagacgagactttccagtcacgcctgaaatccctttcaaacaccttttcggggcggccc
actccgctgtatctggcagaaaggctgactgaacatctggggggtgccagaatttacctg
aaaagggaagacctggcccatacaggtgcccataaaatcaacaacgcactcggtcagggg
ctgcttgccttgcatatgggaaagaaaagggtaattgccgaaacaggggcggggcaacac
ggggtagccaccgcagctgtttgcgccatgctggggctggaatgcattgtctatatgggc
gaagatgacatcaaacgtcaagccttgaacgtattccgcatgaagctgatgggaacggaa
gtcagaagcgtatcttcgggcagccgtaccctgaaagacgccatcaatgaagctatgcgt
gactgggtaagcaacccggagaccacttattatataatcggttcggtggtcggcccgcgc
ccttatccggctatggtacgggattttcaggcagttatcgggcaggaaaccaaagcccag
tccttaagacagctggggggactacctgactgcattgttgcctgtgttggcggaggcagc
aatgccatgggtattttctatgatttcataccagaccaaagcgtacgtcttatcggggtg
gaagctgccggcagcggcatcagcaccggcaaacattcggccacccttagtgccggcaag
gtgggtatactccacggcgccatgtcctacctgcttcaggacgagcatggacaggtgatt
gaaacccacagtatttcggccgggctggattatcccggcgtaggacctgaacacagctac
ctgaaagataataagcgggtggaatatgtttcggtcacagatgaagaagccctgaacggc
ttcaaactgctatgctcgctggaagggataatgcctgctctggaatcttcccacgccatt
gcccatgccctgaaaatagcagtcggcatgccgaaaaacaaaaatatagtcataaacctc
tccggcagaggggacaaagacatggatattgttcaaaaagcaatgggggtaaagatatga

DBGET integrated database retrieval system