KEGG   Dehalococcoides mccartyi 195: DET1488Help
Entry
DET1488           CDS       T00223                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
det  Dehalococcoides mccartyi 195
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DET1488 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DET1488 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DET1488 (trpA)
Enzymes [BR:det01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DET1488 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1345894..1346661
Genome map
AA seq 255 aa AA seqDB search
MSRISDAFQKRKSLIAYITVGYPDIETTLRLVPLLEENGVDIIELGIPFSDPLADGVTIQ
NASYQALQNGVTPEVCLSVAALLKEKISIPMVFMGYYNPIYNYGLTKFCQKCATAGVSGF
IIPDLPPGEAQDIDFAATEAGLDIIFLLAPTSTDERIKLVAAKSRGFIYLVSHSGVTGAT
ANLPADLSSFVNRVRKTARQPLAVGFGISTPEQAQNIAKFSDGIIVGSRILQLVQTDPSL
EKVATFIRQLRQSLD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtatcagtgatgcattccaaaaacgaaaatctcttatagcttacataacagtc
ggctacccggatattgaaaccaccctgcggctggtgcctctgctggaagaaaacggggtg
gatattatagagctgggtattcccttctcagacccgctggcagacggagttactattcaa
aatgccagttatcaggcactccagaacggggtgacgcctgaagtctgtttatctgttgcc
gccctgctcaaagaaaaaatctccatacccatggtattcatgggctattataatcccatt
tacaactacggactgaccaagttctgccaaaagtgtgcaactgcgggtgtaagcggattt
attattcctgacctgccgccgggagaagcccaagacatagactttgccgccacagaagcc
ggcttggatataatctttctgttagcccccaccagtaccgacgaacggattaagctagtt
gccgccaaatcacgggggtttatttatctcgtttcccactcaggcgttaccggggcaact
gccaacttgccggctgatttgagcagttttgtaaacagggtaaggaaaaccgcccgccag
cctctggcagtgggctttggtatttcaacccccgaacaagcccaaaatatcgcaaaattt
tccgacgggataatagtaggcagccgtatcctgcagcttgtccagacagacccttcactt
gaaaaagtagccacatttatcaggcaactcagacaatcattagactaa

DBGET integrated database retrieval system