KEGG   Dehalococcoides mccartyi 195: DET1488Help
Entry
DET1488           CDS       T00223                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
det  Dehalococcoides mccartyi 195
Pathway
det00260  Glycine, serine and threonine metabolism
det00400  Phenylalanine, tyrosine and tryptophan biosynthesis
det01100  Metabolic pathways
det01110  Biosynthesis of secondary metabolites
det01130  Biosynthesis of antibiotics
det01230  Biosynthesis of amino acids
Module
det_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DET1488 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DET1488 (trpA)
Enzymes [BR:det01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DET1488 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AAW39324
UniProt: Q3Z6G1
Position
1345894..1346661
Genome map
AA seq 255 aa AA seqDB search
MSRISDAFQKRKSLIAYITVGYPDIETTLRLVPLLEENGVDIIELGIPFSDPLADGVTIQ
NASYQALQNGVTPEVCLSVAALLKEKISIPMVFMGYYNPIYNYGLTKFCQKCATAGVSGF
IIPDLPPGEAQDIDFAATEAGLDIIFLLAPTSTDERIKLVAAKSRGFIYLVSHSGVTGAT
ANLPADLSSFVNRVRKTARQPLAVGFGISTPEQAQNIAKFSDGIIVGSRILQLVQTDPSL
EKVATFIRQLRQSLD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtatcagtgatgcattccaaaaacgaaaatctcttatagcttacataacagtc
ggctacccggatattgaaaccaccctgcggctggtgcctctgctggaagaaaacggggtg
gatattatagagctgggtattcccttctcagacccgctggcagacggagttactattcaa
aatgccagttatcaggcactccagaacggggtgacgcctgaagtctgtttatctgttgcc
gccctgctcaaagaaaaaatctccatacccatggtattcatgggctattataatcccatt
tacaactacggactgaccaagttctgccaaaagtgtgcaactgcgggtgtaagcggattt
attattcctgacctgccgccgggagaagcccaagacatagactttgccgccacagaagcc
ggcttggatataatctttctgttagcccccaccagtaccgacgaacggattaagctagtt
gccgccaaatcacgggggtttatttatctcgtttcccactcaggcgttaccggggcaact
gccaacttgccggctgatttgagcagttttgtaaacagggtaaggaaaaccgcccgccag
cctctggcagtgggctttggtatttcaacccccgaacaagcccaaaatatcgcaaaattt
tccgacgggataatagtaggcagccgtatcctgcagcttgtccagacagacccttcactt
gaaaaagtagccacatttatcaggcaactcagacaatcattagactaa

DBGET integrated database retrieval system