KEGG   Dehalococcoides mccartyi 195: DET1603Help
Entry
DET1603           CDS       T00223                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
det  Dehalococcoides mccartyi 195
Pathway
det00790  Folate biosynthesis
det01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:det00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DET1603 (folP)
Enzymes [BR:det01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DET1603 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AAW39125
UniProt: Q3Z651
Position
1437031..1437879
Genome map
AA seq 282 aa AA seqDB search
MDLPAKKPVESLFGSKQFGWGERTYIMGIVNVTADSFSGDGLGANPEAALEQARRFALEG
ADILDIGGESTRPGSQPVNTREELDRVIPAVRLISRNLDIPVSVDTYRREVAEEALKAGA
CIINDVWGLKKDPSLFELAAKRPAGWVITSNQRENPAEDIMAAVTSELRETALRLLGLGV
PARNIIIDPGVGFGKTLEQNLEIVRRLSELKTLNLPILLGTSRKSLIGQVLDTPPGERLE
GTAATVALGIGGGADIVRVHDVAYMKRVCRMSDAVVRGKIWK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatttacccgcaaaaaaacctgtagaaagcctcttcggctcaaaacaattcggctgg
ggagagcgtacctacataatgggtatagtcaatgtcaccgctgactcattttcaggtgac
ggactgggtgctaaccccgaagccgctctggaacaggcccgccgttttgctctggaaggg
gcagatatactggatataggcggtgaaagcacccgcccgggcagccagccggtaaacacc
cgggaagaactggacagggtcataccggcggttaggcttatttcccgaaatctggatata
cccgtaagcgtagatacctaccggcgagaagtggcggaagaagccctgaaagccggcgcc
tgcataataaatgatgtctgggggttaaaaaaagacccttccctttttgagctggcagcc
aaaaggcctgccggctgggtgataacctccaaccagcgggaaaacccggcggaagatata
atggcggcagtcaccagcgaactgagggaaactgccctgaggctgcttggcttgggtgta
cccgcccgaaatattattattgaccccggagtggggttcggcaaaaccctggagcaaaat
ctggaaattgtccgccgtttgtcagaactgaaaaccctaaatctgcctatactgctgggc
acttcccgcaaatcccttatcgggcaggtgctggacaccccgccgggcgaaaggctggaa
gggacggccgccacggttgccctggggatagggggcggggcggatattgtaagggtgcat
gatgtagcctatatgaaacgggtctgccggatgagtgatgctgttgtaaggggtaaaata
tggaaataa

DBGET integrated database retrieval system