KEGG   Dehalococcoides mccartyi VS: DhcVS_1007Help
Entry
DhcVS_1007        CDS       T01136                                 

Gene name
fbp
Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DhcVS_1007 (fbp)
   01230 Biosynthesis of amino acids
    DhcVS_1007 (fbp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DhcVS_1007 (fbp)
   00030 Pentose phosphate pathway
    DhcVS_1007 (fbp)
   00051 Fructose and mannose metabolism
    DhcVS_1007 (fbp)
  Energy metabolism
   00680 Methane metabolism
    DhcVS_1007 (fbp)
Enzymes [BR:dev01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DhcVS_1007 (fbp)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DhcVS_1007 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942237..943334
Genome map
AA seq 365 aa AA seqDB search
MKVTLSVIKADIGGFVGHSDSHPQCLVRAEKHLAEAKKNGMLIDYHITKCGDDLQLVMTH
QKGINNKVIHEMAWDTFVSCTEVAKELKLYGAGQDLLCDAFSGNVKGMGPGVAEMELEER
PSEPIIIFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHDGFSFEVHDVKESKGISF
NTPEEIYDMLVFIGAHSRFAIKSVSTRKGEIAAVSSTQKLAFLADRYVGKDDPVCIVRAQ
GSFPAVGEILEPFAQPYLVEGWMRGSHNGPIMPVSIEDSTPTRFDGPPRVTALGFQLSNG
MLIGPRDMFKDKSFDNARQKSLDMADMMRSHGPFEPHRLPLEEMEYTTMPQVSKKLAGRF
KPLED
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccctgagtgttattaaagcagatatcggcggttttgtaggccattcggac
tcacacccgcagtgtctggtcagggctgaaaagcacctggcagaggctaaaaagaatggc
atgctgattgattaccatattaccaaatgcggtgatgacctccagcttgtcatgacccac
cagaaaggtataaacaacaaagttatccacgaaatggcttgggataccttcgtaagctgc
accgaagttgccaaagagctgaagctttacggcgccgggcaggacttgctgtgtgatgcc
ttctccggaaacgtaaagggcatgggtcccggcgtagccgaaatggagcttgaggaacgg
ccttccgaacctatcataatcttcatggccgacaagacctcttccggtgcctggaatctg
cctctttacaaaatgtttgctgacccctttaacaccataggtctggtcatagccgaaaac
atgcatgacggcttctcttttgaagtacatgacgtaaaggaaagcaagggcattagcttt
aacacccccgaagaaatctatgacatgctggtatttatcggcgcccattcccgcttcgct
attaaaagcgtttccacccgcaagggcgagattgcggctgtttcttccacccagaaactg
gcctttttggctgaccgttatgtaggtaaagacgacccggtttgtattgtccgcgcccaa
ggttctttcccggctgtgggtgaaatacttgaacccttcgcccagccttatctggtagaa
ggctggatgcgcggctcgcacaacggccctattatgcctgtctcaatagaagacagcacc
cccacccgctttgacggcccgccccgggtaaccgctctgggtttccagctgtcaaacggt
atgcttatcggcccgcgtgatatgtttaaagataagtcttttgacaatgcccgccagaaa
tcactggatatggcagatatgatgcgctcccacggcccatttgagccccatcgcctgccg
ctggaggaaatggaatacaccaccatgcctcaggtatccaagaaactggccggacgcttt
aaacccctggaagactag

DBGET integrated database retrieval system