KEGG   Dehalococcoides mccartyi VS: DhcVS_1128Help
Entry
DhcVS_1128        CDS       T01136                                 

Definition
carbohydrate kinase, PfkB family
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DhcVS_1128
   01230 Biosynthesis of amino acids
    DhcVS_1128
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DhcVS_1128
   00030 Pentose phosphate pathway
    DhcVS_1128
   00051 Fructose and mannose metabolism
    DhcVS_1128
   00052 Galactose metabolism
    DhcVS_1128
  Energy metabolism
   00680 Methane metabolism
    DhcVS_1128
Enzymes [BR:dev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DhcVS_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1040480..1041412
Genome map
AA seq 310 aa AA seqDB search
MITTVTLNPCLDKHIDVHGLVLYETNRWHLMSKYAGGKGIDVSRAIHEMGNDTIACGFLG
GEEGREIETLLAKQGLKYRFTPISQPTRSCFIIYDTKTRRQTNLNAPGPRITPSELKLFH
EDLQRESASSNIIVMSGSVPPGVPSNVYFTLIKSAHKLGKQTILDTTGKYLRAGLKAKPC
LVKPNIREAEELLGRKLETEAEIILGAKEIVQMGAGIAVISMGKKGLIASDGKQVIKASS
PYVRVKSAVGAGDSTVAGLAISLCRGDSLEEACRLGVAMGTAAVMTPGTELCHREDVLYW
LPRIKIRRLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattaccactgttaccctaaacccctgtctggacaaacatatagacgtgcatggtctg
gtactgtacgaaactaaccgctggcatctcatgtccaaatatgccggcggtaaaggcata
gatgtgtcacgggctatacatgaaatgggaaatgataccattgcctgcggttttctgggc
ggtgaagagggacgggagatagaaaccctgcttgcaaaacaggggcttaaataccgcttc
acccccataagccagcctacccgaagctgctttataatatacgacactaaaacccgccgc
cagactaaccttaacgcccccggcccgcggataacgccgtctgaactgaaactttttcac
gaagacctgcaaagggaaagcgcttcgtcaaacattattgttatgtcaggcagcgtaccg
ccgggagtaccttcaaacgtctatttcacccttatcaagagtgcccataaactgggcaag
caaaccatactggataccaccggcaaatacctgcgggcagggcttaaggctaaaccctgt
ctggtaaagcccaatatccgcgaagcggaagagctgctgggcaggaaactggaaaccgag
gctgaaataatactaggggctaaggaaatagtccaaatgggagcaggcatagcggtaatc
tccatgggcaaaaaagggctgatagccagtgacggcaagcaggtgataaaagccagctct
ccctatgtgcgggtaaaaagcgcggtgggggcgggtgattcaacggtggccggcttggcc
atatccctctgccgaggagacagcctggaagaagcctgccgtttaggtgtagccatgggc
acagccgccgtgatgacgccgggcaccgaactctgccaccgcgaagacgttttgtactgg
ctgccccgcattaaaatccgccgtctggcttag

DBGET integrated database retrieval system