KEGG   Dehalococcoides mccartyi VS: DhcVS_1257Help
Entry
DhcVS_1257        CDS       T01136                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DhcVS_1257 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DhcVS_1257 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DhcVS_1257 (trpB)
Enzymes [BR:dev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DhcVS_1257 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1156241..1157440
Genome map
AA seq 399 aa AA seqDB search
MPEVNSNCKPGYFGKYGGQFVPEILVPVLNELEQAYEKAKTDEAFQSRLKYLSNTFSGRP
TPLYAAERLTEYLGGARIYLKREDLAHTGAHKINNALGQGLLAQHMGKKRVIAETGAGQH
GVATAAVCAMLGLECIVYMGEDDIKRQALNVFRMKLMGTEVRSVSSGSRTLKDAINEAMR
DWVSNPETTYYIIGSVVGPRPYPAMVRDFQAVIGQETKDQSLKQLGGLPDCIVACVGGGS
NAMGIFYDFIPDQSVRLIGVEAAGSGISTGKHSATLSAGKVGILHGAMSYLLQDEHGQVI
ETHSISAGLDYPGVGPEHSHLKDSKRVEYVSVTDDEALNGFKLLCSLEGIVPALESSHAI
AHALKIAGNMPKDKNIVINLSGRGDKDMDIVQKAMGVNL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagtaaacagcaactgtaaaccggggtatttcggcaagtatggcggccagttc
gtgcctgaaatactggtacccgtcctgaacgaactggaacaggcttacgaaaaagccaaa
acagatgaggcctttcagtcacgcctgaaatacctttcaaataccttttcggggcgtccc
actccgctgtatgcggccgaaaggctgaccgaatatctggggggtgcccgtatttatctg
aaacgggaagacctggcccataccggcgcccacaaaatcaataatgccctgggtcagggt
ctgctggcacagcacatgggcaagaaaagggtaattgccgaaaccggggcggggcagcac
ggggtggccactgcggccgtctgcgccatgctggggctggaatgtattgtctacatgggc
gaagacgatatcaaacgccaggccttaaatgtattccgcatgaagctgatgggaacggaa
gtcagaagtgtttcttcgggcagccgcaccctgaaagatgccatcaacgaagccatgcgt
gactgggtaagcaacccggaaaccacttattacataatcggctcggtagtcggcccgcgc
ccttaccctgccatggtacgggattttcaggccgttatcgggcaggaaaccaaagaccag
tcactaaaacagctgggggggctgccggactgtatagtggcctgcgtaggcggcggcagt
aatgccatgggcattttttatgatttcatacctgaccaaagcgtacgccttataggggtg
gaagccgccggcagcggcataagcaccggcaaacattcggctaccctgagtgccggcaaa
gtgggcatacttcacggagccatgtcctacctgctgcaggacgagcatgggcaggtaatt
gaaacccacagcatttcggcaggactggattaccccggcgtaggcccggagcacagccat
ctgaaagacagcaaacgggtggaatatgtttcggtaacagatgatgaagccctgaatggc
tttaaactcctttgttcactggaagggattgtacccgcactggaatcatcccacgccatt
gcccacgccctgaaaatagcgggtaatatgcccaaagataaaaatatagtcataaacctg
tccggcaggggagataaagatatggatattgtccagaaagcaatgggggtgaacctatga

DBGET integrated database retrieval system