KEGG   Dehalococcoides mccartyi VS: DhcVS_1258Help
Entry
DhcVS_1258        CDS       T01136                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
dev00260  Glycine, serine and threonine metabolism
dev00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dev01100  Metabolic pathways
dev01110  Biosynthesis of secondary metabolites
dev01130  Biosynthesis of antibiotics
dev01230  Biosynthesis of amino acids
Module
dev_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DhcVS_1258 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DhcVS_1258 (trpA)
Enzymes [BR:dev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DhcVS_1258 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: ACZ62360
UniProt: D2BJ60
Position
1157437..1158204
Genome map
AA seq 255 aa AA seqDB search
MSRISDAFSKRKPLIAYITVGYPDVETTLKLVPMLEANGVDIIELGIPFSDPLADGVTIQ
NASYQALQNGVTPEVCLSVAARLKEKTSIPMVFMGYYNPIYNYGLSEFCNKAAAAGISGL
IIPDLPPGEAEDIEAAAKEAGLDIIFLLAPTSTDERIKLVAAKSGGFIYLVSHSGVTGAT
SNLPADLGSFVSRVRKAASQPLAVGFGISTPEQTADISKYADGVIVGSRIIQLVQADPSL
EKVSGFVRQLRKALD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcagtgatgcatttagcaaacgcaaaccccttatagcttacataacagtc
ggctatccggatgttgaaaccaccttgaaactggtgcctatgctggaagcaaacggggtg
gatattatagagctgggcattcccttttcagaccccttggcagacggggtcactattcag
aacgccagctaccaggcacttcagaacggggtaacccctgaagtctgtttatcagttgcc
gcccgtttaaaagaaaaaacctctatacccatggtgtttatggggtattacaacccgatt
tacaattacggcctgagcgaattctgcaataaggcggccgccgccggtataagcggcctt
attattcctgacctgccgccgggtgaggccgaagatatagaagcagccgccaaagaagcc
gggctggatataatcttcctgttagcccccaccagcacagacgaacggattaaactggta
gccgccaaatcaggggggtttatctaccttgtttcccactcaggtgttactggggcaacg
agcaaccttccggctgacctcggcagtttcgtaagcagggtcaggaaggccgccagccag
cctctggcagtgggtttcggcatttccacccccgaacagaccgccgatatctcaaaatat
gctgacggggtcatagtaggcagccgcattatccagctggtacaggcagacccatcactt
gaaaaggtaagcggctttgtcaggcagctaagaaaggcacttgactaa

DBGET integrated database retrieval system