KEGG   Dehalococcoides mccartyi VS: DhcVS_1258Help
Entry
DhcVS_1258        CDS       T01136                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DhcVS_1258 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DhcVS_1258 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DhcVS_1258 (trpA)
Enzymes [BR:dev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DhcVS_1258 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1157437..1158204
Genome map
AA seq 255 aa AA seqDB search
MSRISDAFSKRKPLIAYITVGYPDVETTLKLVPMLEANGVDIIELGIPFSDPLADGVTIQ
NASYQALQNGVTPEVCLSVAARLKEKTSIPMVFMGYYNPIYNYGLSEFCNKAAAAGISGL
IIPDLPPGEAEDIEAAAKEAGLDIIFLLAPTSTDERIKLVAAKSGGFIYLVSHSGVTGAT
SNLPADLGSFVSRVRKAASQPLAVGFGISTPEQTADISKYADGVIVGSRIIQLVQADPSL
EKVSGFVRQLRKALD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcagtgatgcatttagcaaacgcaaaccccttatagcttacataacagtc
ggctatccggatgttgaaaccaccttgaaactggtgcctatgctggaagcaaacggggtg
gatattatagagctgggcattcccttttcagaccccttggcagacggggtcactattcag
aacgccagctaccaggcacttcagaacggggtaacccctgaagtctgtttatcagttgcc
gcccgtttaaaagaaaaaacctctatacccatggtgtttatggggtattacaacccgatt
tacaattacggcctgagcgaattctgcaataaggcggccgccgccggtataagcggcctt
attattcctgacctgccgccgggtgaggccgaagatatagaagcagccgccaaagaagcc
gggctggatataatcttcctgttagcccccaccagcacagacgaacggattaaactggta
gccgccaaatcaggggggtttatctaccttgtttcccactcaggtgttactggggcaacg
agcaaccttccggctgacctcggcagtttcgtaagcagggtcaggaaggccgccagccag
cctctggcagtgggtttcggcatttccacccccgaacagaccgccgatatctcaaaatat
gctgacggggtcatagtaggcagccgcattatccagctggtacaggcagacccatcactt
gaaaaggtaagcggctttgtcaggcagctaagaaaggcacttgactaa

DBGET integrated database retrieval system