KEGG   Dehalococcoides mccartyi VS: DhcVS_348Help
Entry
DhcVS_348         CDS       T01136                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase, homoserine kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DhcVS_348 (ispE)
Enzymes [BR:dev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DhcVS_348 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337737..338615
Genome map
AA seq 292 aa AA seqDB search
MPGIYGEPMLTLLAPAKVNLSLEVLYRRNDGYHELRSIVQSLSLCDRLSFSPAKMVQISS
DSPDWQPEHSLVSKAVTLFSEKCGQNSGVNLKIAKRIPLVSGLGGDSSCAAAVLKGLNKL
WGCGYPCWRLMEIGAELGSDVPFFIMGGTAMMEGRGETVTPLPTLNQMWAVLLVPPISMP
SDKTAVLYRNLHPDSFTSGEIGDKLLEDICHGKLSPSLCFNVFEKVAFTLFPELVKYRWQ
FLEAGAYQISLAGAGPTLFTLLKDKNTAEKIYHNLCQKGHQAYLVSTLGPLD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaatatacggtgaacccatgctgacactgctggctcctgccaaagtcaacctt
agtctggaagtactctaccgcagaaatgacggttaccatgagttgcgaagcattgttcag
tctctgagtttgtgtgaccgcctgtctttcagccccgctaaaatggtacagataagctca
gacagcccggactggcagcccgaacatagcctagtttcgaaagcagtgacattgtttagt
gaaaaatgcgggcaaaacagcggggtgaacctcaaaatagccaaacgcattcctctggtt
tccggactgggtggagacagctcttgtgcggcggctgttttgaaagggcttaacaagctt
tggggatgcggttatccctgctggcggctgatggaaataggtgcagaacttggttctgat
gtcccctttttcataatgggtggtacggctatgatggaaggacggggagaaacggtaact
cctctgcctacccttaaccagatgtgggcggttttgctggttccgccaatttcaatgccg
tcggataagactgccgttctctatcgcaatctgcacccggacagctttaccagcggtgaa
ataggtgataaactgctggaagatatttgtcatggcaagcttagccccagcctttgtttc
aacgtttttgagaaagtagcttttacccttttccccgaactggttaaataccgctggcag
tttttggaagcaggggcataccagatatctttggccggagcaggcccgaccctgtttacc
ctgcttaaagataaaaatacggctgaaaaaatatatcataacctgtgccaaaaagggcat
caggcctacttggtatcgaccttggggccgctggattga

DBGET integrated database retrieval system