KEGG   Dehalococcoides mccartyi VS: DhcVS_49Help
Entry
DhcVS_49          CDS       T01136                                 

Gene name
nagC
Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DhcVS_49 (nagC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DhcVS_49 (nagC)
   00052 Galactose metabolism
    DhcVS_49 (nagC)
   00500 Starch and sucrose metabolism
    DhcVS_49 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    DhcVS_49 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DhcVS_49 (nagC)
   00524 Butirosin and neomycin biosynthesis
    DhcVS_49 (nagC)
Enzymes [BR:dev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DhcVS_49 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
40138..41142
Genome map
AA seq 334 aa AA seqDB search
MNRSNLEVILKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCARNGAEGVFENICRVLE
RLLERNNLCLSQFEALSAAVAGGIDMPNGLVTQSPHLPAWRDVPLRDMLAERYLKTFLIN
DASAAALAEHKLGVGRGVKNLVYLTVSTGIGGGIIINDELYLGQSGCAGEIGHMCLDING
TEDVCGNVGCLETLASGTAIVRRVQAELAGGEFSLLSERFRADYSALTAEDIGRAASEGD
RLCQGVIRRAGEYLGIGLAGIANIFNPELIILGGGVSKLGEIFIEPARKMLFKRAFRLAG
DDVRLVASFLGDNAGVTGAALYAYGCLGDGNKTP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccggagtaatttagaggtcatacttaagccctgtttgtgcctggatataggcggc
agtaaaatccgctcggcggtagtgacccatgacggacgggtggtggcctgggaacaggag
cctacctgcgctcggaacggggcggagggtgtatttgagaatatatgccgggtgcttgag
cgcctgcttgagcgtaacaatctttgtctttcccagtttgaggccctgtctgcggcggta
gccgggggcatagatatgccaaacggactagttacccagtctccccatctgcccgcctgg
cgggatgtaccccttcgggatatgctggcagagcgttatcttaaaacattccttataaat
gatgcctccgccgctgctttggccgaacacaaactgggagtggggcggggggttaaaaac
ctggtttacctgacggtctccaccggtatcgggggcggtattattataaatgatgagctt
tatctggggcagagcggctgtgccggtgaaataggtcatatgtgtctggatataaacggc
actgaagatgtctgcggcaatgtaggctgtctggaaacgctggcttcgggtacggctatt
gtccgcagggttcaggctgaacttgccgggggtgagttttccctgctttcagagcggttt
agggcggattactctgctttgacggctgaggatatcggccgggcggcttccgaaggtgac
aggctgtgccagggggttatccgccgggcaggtgaatatttaggtataggtctggctggt
attgccaatatatttaaccctgagcttattatactggggggcggggtttccaaactaggg
gagatttttattgagcctgcccgcaaaatgcttttcaaacgggccttccgtctggctggg
gatgatgtccggctggttgcttcgtttctgggggataatgccggggtgaccggggcggca
ctttatgcctacggctgtctgggggatggaaataaaaccccttag

DBGET integrated database retrieval system