KEGG   Dehalococcoides sp. VS: DhcVS_522Help
Entry
DhcVS_522         CDS       T01136                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
dev  Dehalococcoides sp. VS
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dev03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(489736..490350)
Genome map
AA seq 204 aa AA seqDB search
MKDTSLPSTAGAVNKLIDSLGKLPGIGPKSAQRLAFYLMRAPEEQVLALSDTIRSIKNQI
SQCRICFNVADSELCPICQNTKRETNKICVVEQPQDILALEHVGVYRGYYHVLHGAISPT
EGITSQNIRISELMSRLDNGQVDEIILATNPTTEGEATAMYLSRLITPLGIKVTRLARGL
PFGTELEYADDVTLSRAMEGRQNF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggatacttctttaccgtctacagccggtgcagtaaacaagctgatagattcgctg
ggcaaactcccgggcataggtccgaaaagcgcccagcggctggctttttacctgatgcgg
gcgcctgaagaacaggttctggccctttctgatactatccgcagtatcaagaaccagata
agccagtgccgtatctgctttaacgtggctgacagtgagctttgcccaatctgccagaat
accaaacgcgaaacaaacaagatttgcgtggtggaacagccgcaggatattttggcactg
gaacacgtgggcgtctaccgaggctattaccatgtactgcatggagctatttcccccacc
gagggaataacatcccagaatatacgcataagcgagcttatgagccggctggataacggc
caggtagacgagattattctggcaaccaaccccactaccgagggtgaggccaccgccatg
tacctttcgcgactgataaccccgctgggtataaaagtgaccagactggcacggggatta
ccctttggaacagaactggaatatgctgatgatgtaaccttaagccgggccatggaggga
cgccaaaatttctag

DBGET integrated database retrieval system