KEGG   Dehalococcoides mccartyi VS: DhcVS_551Help
Entry
DhcVS_551         CDS       T01136                                 

Definition
radical SAM superfamily protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dev  Dehalococcoides mccartyi VS
Brite
Enzymes [BR:dev01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DhcVS_551
Transfer RNA biogenesis [BR:dev03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    DhcVS_551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521163..522542
Genome map
AA seq 459 aa AA seqDB search
MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFDATPQSYTPESPAVLRAKSCEYQAYKQ
VALRLRIIQDMGHPTDKVELIVMGGTFLSADTAYQYGFIKDCYDALNGIVAGSLEEAKTI
NETAQHRCVGLCIETRPDICGETEIQRMIDFGTTRVELGVQMLDDDIYKLVERGHTVADV
AEATRLLREYGLKVHYHWMPGLPGSAPEKDLALSRMVFEDPRFCPDGLKLYPTMVVEGTV
LEEWWKEGRYTPYPSDIMTGLIADIKALVPPYVRISRVLRDIPAVFISAGLKDSLRDGVR
QILESRHQKCRCIRCREYGHRQRKGQTSGEPTLRRLDYPASEGNEIFLSFEDSSDTLYGL
LRLRIPRLSLPVPDKKYGGKIGLVRELHVYGIELSLGEQRDQSAQHRGLGRKLVAEAERL
AHDEYGLSSLAILSGVGAREYYRSLGYELSAGYMCKRLA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctttcccgaacaatatcaggcgttaccccggtggcggttatgaccaaacct
ctgccgtgtcccggcaagtgcatatattgtcctacttttgatgccactccccagagctat
acacctgaatctccggctgttttgcgggctaaaagctgtgaatatcaggcttacaaacag
gttgcccttcgcctgcggataatacaggatatgggtcaccctacagataaggttgagctt
atagttatgggtggtactttcctttcagcagataccgcctaccagtatggtttcattaaa
gactgctatgatgcgttgaatgggatagtggctggcagtctggaggaagctaagactata
aatgaaactgctcagcaccgctgcgtaggtttatgcattgagacccgcccggatatctgc
ggtgagaccgaaatacagcggatgatagatttcggaactaccagagtggaacttggcgtc
cagatgctggatgatgatatttataaactggttgaacggggacatacagttgcggatgtg
gctgaggccacccgccttttgcgtgaatacggcctaaaagtgcattaccactggatgccc
ggacttcccggttcagcccctgaaaaagatctggcactttcccgcatggtgtttgaagat
ccccggttttgccctgacgggcttaagctttatcccactatggtagtggaggggactgta
cttgaggagtggtggaaagaaggcagatatacaccgtacccaagtgacatcatgaccggg
cttattgcggatattaaagctctggtgccgccttatgtgcgtatctcacgagttcttcgg
gacataccggcggtatttatcagcgcgggactcaaagactccctgagggatggtgttcgg
cagatactggaaagccgccaccaaaagtgcaggtgtatacgctgtcgtgaatatggccac
cgccagcggaaaggacaaaccagtggtgaacccaccttaaggcgacttgattatcctgct
tcagagggcaacgagatatttcttagctttgaggattcttccgataccctttatggtttg
ctcaggttgcgtatacctcgtttatccctgcctgttccggataaaaaatacggcggtaaa
atagggctggtacgtgaactgcatgtatatggcatagaactctcactgggtgaacagaga
gaccagtctgcccagcaccggggtcttggcagaaagctggtggccgaggcagaacggctt
gcccatgacgaatacggccttagctcactggcaatactaagcggtgtgggcgccagagag
tattaccgttcactcgggtatgaactttcggcagggtatatgtgtaagcgtctggcttga

DBGET integrated database retrieval system