KEGG   Dehalococcoides mccartyi VS: DhcVS_618Help
Entry
DhcVS_618         CDS       T01136                                 

Definition
sugar kinase ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DhcVS_618
Enzymes [BR:dev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DhcVS_618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(581654..582640)
Genome map
AA seq 328 aa AA seqDB search
MTACRLEAIGLGAVHVDHIYTVEQILHDGECVVTESALFPGGSGANTIHGLSRLGLKCGF
IGAVGNDPDGNLLIKDFENAGIDNRYLMVKNEAQTGSVVSLSESSGRRSTYVNPGANNYL
DLSDINLEYLSQAKLVHMSTFFNQNEFALCHEIAERLAPGVLFSFSPGALFAAQGLKRLA
PILSRTNALFTNQQDIEKMTQKNYQRATDMCIRSGCEHVVVTLGESRRFQRKGKITLQTY
IRDKDHECHMESTVSLRKDIRTVVDTIGAADAFTTGFLFGLMGDKPIEECGLLGDISARF
CISKLGARSGLPDLAGLKERFGMHYFTN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactgcttgtcgtcttgaggctatcggcctgggggcggtgcatgtagaccatatatac
actgtagaacagatactccatgacggggaatgcgtagttaccgaatctgctttatttccc
ggcggttcgggtgccaataccatacacgggctgtcccgtctgggattaaaatgcggtttc
ataggggcagtggggaatgaccctgatggaaacttgttaattaaggattttgaaaatgct
ggcatagataaccggtatctgatggtaaaaaacgaagcccaaacaggctccgtggtttcc
ctgagcgagtcttcaggacgccgctcaacatatgtaaatcccggtgccaacaattatctt
gacctttctgatataaatctggaatacctaagtcaggctaaactggttcacatgtccacc
ttttttaaccagaacgaatttgccctttgccacgaaatagcggaacggctggcaccaggt
gtactttttagtttttcccccggagccctctttgccgcccaaggcttaaaaaggcttgca
cccattctttcccgcaccaatgccctcttcaccaaccagcaggatatagaaaaaatgacc
cagaaaaactatcagcgtgctacagatatgtgtatccgcagcgggtgtgaacatgtagtg
gtaactctgggggagagccgtcgttttcagcgaaaaggcaaaataacactccagacctat
atacgggacaaagaccacgaatgccatatggagtcaaccgtaagcctccggaaagatatc
cgtaccgtagttgatacaataggtgcggcagatgcttttactaccggttttcttttcgga
ttgatgggtgataaacctattgaagagtgcggtttgctgggtgatatttccgctcgtttt
tgtataagcaaactgggagcccgctcagggctgcctgaccttgcggggctgaaagaacgc
tttggtatgcactactttaccaactaa

DBGET integrated database retrieval system