KEGG   Dehalococcoides mccartyi VS: DhcVS_630Help
Entry
DhcVS_630         CDS       T01136                                 

Gene name
porG
Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DhcVS_630 (porG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DhcVS_630 (porG)
   00020 Citrate cycle (TCA cycle)
    DhcVS_630 (porG)
   00620 Pyruvate metabolism
    DhcVS_630 (porG)
   00640 Propanoate metabolism
    DhcVS_630 (porG)
   00650 Butanoate metabolism
    DhcVS_630 (porG)
  Energy metabolism
   00680 Methane metabolism
    DhcVS_630 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DhcVS_630 (porG)
Enzymes [BR:dev01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DhcVS_630 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
592141..592713
Genome map
AA seq 190 aa AA seqDB search
MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNN
PIRERSGISQPDIVVVLDPSLVIIGNVVSGLKEGGTLIINTTKPLEYFASQYGDRWKVAT
VDATAIAKEVLGVNIVNTTMLGALIKATALADMEAFEEPLKHRFGKLAAKNMAAMKKAFE
ETAVKELKVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttattgaaatcagatggcatgggcgtggcggtcagggtgcggtaacctca
gccgagcttatcgcccaggcggcaattggcaaggggaaatatgctcaggcttttcccagt
ttcgggcctgaacgcagaggtgctccggttcaatctttcaaccgtatcagtgacaacaat
cctatccgtgagcgttccggcataagccagccggatattgtggtagtacttgaccccagc
ctggttatcatcgggaatgtagtttcaggccttaaagaaggcggcacccttattatcaat
accaccaagccgctggagtattttgcttctcagtatggtgaccgctggaaagtagccaca
gttgatgcaactgctattgccaaagaagtattaggcgtaaatattgtcaatacaaccatg
cttggtgctcttataaaggcaactgctctggcggatatggaagccttcgaagaaccttta
aaacaccgcttcggaaagctggctgctaaaaatatggcagctatgaaaaaggcctttgaa
gagactgctgtaaaggagcttaaagttggctaa

DBGET integrated database retrieval system