KEGG   Dehalococcoides sp. VS: DhcVS_630Help
Entry
DhcVS_630         CDS       T01136                                 

Gene name
porG
Definition
2-oxoacid:ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
dev  Dehalococcoides sp. VS
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:dev01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dev00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dev00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dev00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dev00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dev00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:dev00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dev00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592141..592713
Genome map
AA seq 190 aa AA seqDB search
MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNN
PIRERSGISQPDIVVVLDPSLVIIGNVVSGLKEGGTLIINTTKPLEYFASQYGDRWKVAT
VDATAIAKEVLGVNIVNTTMLGALIKATALADMEAFEEPLKHRFGKLAAKNMAAMKKAFE
ETAVKELKVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttattgaaatcagatggcatgggcgtggcggtcagggtgcggtaacctca
gccgagcttatcgcccaggcggcaattggcaaggggaaatatgctcaggcttttcccagt
ttcgggcctgaacgcagaggtgctccggttcaatctttcaaccgtatcagtgacaacaat
cctatccgtgagcgttccggcataagccagccggatattgtggtagtacttgaccccagc
ctggttatcatcgggaatgtagtttcaggccttaaagaaggcggcacccttattatcaat
accaccaagccgctggagtattttgcttctcagtatggtgaccgctggaaagtagccaca
gttgatgcaactgctattgccaaagaagtattaggcgtaaatattgtcaatacaaccatg
cttggtgctcttataaaggcaactgctctggcggatatggaagccttcgaagaaccttta
aaacaccgcttcggaaagctggctgctaaaaatatggcagctatgaaaaaggcctttgaa
gagactgctgtaaaggagcttaaagttggctaa

DBGET integrated database retrieval system