KEGG   Dehalococcoides mccartyi VS: DhcVS_631Help
Entry
DhcVS_631         CDS       T01136                                 

Gene name
porD
Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, delta subunit
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DhcVS_631 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DhcVS_631 (porD)
   00020 Citrate cycle (TCA cycle)
    DhcVS_631 (porD)
   00620 Pyruvate metabolism
    DhcVS_631 (porD)
   00640 Propanoate metabolism
    DhcVS_631 (porD)
   00650 Butanoate metabolism
    DhcVS_631 (porD)
  Energy metabolism
   00680 Methane metabolism
    DhcVS_631 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DhcVS_631 (porD)
Enzymes [BR:dev01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DhcVS_631 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
592706..593002
Genome map
AA seq 98 aa AA seqDB search
MAKQENQITWQEVTPGCIVSEPGNASQYKTGDWRSQLPIHNFKKCIKCGVCYIFCPEGCI
NETKEGFFEADLFYCKGCGICAHECPTGAIVMKDEEEK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaacaggaaaaccagattacatggcaagaagtaacacccggctgtatagtcagt
gaacccgggaatgccagtcagtacaagacgggtgattggcgttctcaattgcctattcat
aatttcaagaagtgcataaaatgcggcgtgtgctatatattttgccctgaaggttgcata
aatgagaccaaagagggcttttttgaagcagaccttttctattgcaaaggctgcggtatc
tgcgctcatgaatgtcccactggagctattgttatgaaggatgaggaggagaaataa

DBGET integrated database retrieval system