KEGG   Dehalococcoides mccartyi VS: DhcVS_633Help
Entry
DhcVS_633         CDS       T01136                                 

Gene name
porB
Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
dev00010  Glycolysis / Gluconeogenesis
dev00020  Citrate cycle (TCA cycle)
dev00620  Pyruvate metabolism
dev00633  Nitrotoluene degradation
dev00640  Propanoate metabolism
dev00650  Butanoate metabolism
dev00680  Methane metabolism
dev01100  Metabolic pathways
dev01120  Microbial metabolism in diverse environments
dev01130  Biosynthesis of antibiotics
dev01200  Carbon metabolism
Module
dev_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DhcVS_633 (porB)
   00020 Citrate cycle (TCA cycle)
    DhcVS_633 (porB)
   00620 Pyruvate metabolism
    DhcVS_633 (porB)
   00640 Propanoate metabolism
    DhcVS_633 (porB)
   00650 Butanoate metabolism
    DhcVS_633 (porB)
  Energy metabolism
   00680 Methane metabolism
    DhcVS_633 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DhcVS_633 (porB)
Enzymes [BR:dev01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DhcVS_633 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACZ61776
UniProt: D2BHH6
Position
594174..595115
Genome map
AA seq 313 aa AA seqDB search
MQNYSVFVPKLLPKRELFAPGHRGCIGCGEALAVRLATKAMDENTIMVNATGCMEIIASQ
YPYTSWRLPWIHTLFENTAAVASGVESAIKVLKRKKRIEDRDIKIVAIGGDGATVDIGLQ
ALSGAMERGHNFTYICFDNEAYMNTGIQRSSATPFGASTTTSPAGKVGKGQFSWKKDMPA
IAVAHNIPYVATCCPSYPFDMIEKVSKALAADGPAYIHCLSVCPTGWRCATEDTIKIGRL
AVETGVFPLYEVINGQYKLSMETPELKPLREYTSLQRRFRHLTEESLDLIQERVQLEYNK
IAERAACAPKLEK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactattcagtatttgttcccaagctactgcccaaacgtgagttgtttgccccc
gggcatcgcggatgtataggttgcggcgaggctctggcagttcgtctggctaccaaggct
atggatgaaaataccataatggtaaatgccaccggctgtatggaaattatcgcttcccag
tatccgtatacctcatggcgtttgccatggatacataccctgtttgaaaatacggctgcg
gttgcttccggtgttgagtcggccattaaggtgcttaaacgcaaaaagcggatagaagac
agggatataaagattgtagccatcggcggtgacggtgcgactgtagatattggtcttcag
gcactttcaggcgctatggaacgcggtcacaatttcacctatatttgttttgacaacgaa
gcttatatgaataccggtattcagcgttcctcagctactcctttcggtgcgtccactact
acctcaccggccggtaaagtaggtaaaggtcaattctcatggaaaaaagatatgccggca
atagctgttgctcacaatatcccgtatgttgctacctgttgccccagctatccttttgac
atgattgaaaaagtcagcaaagctttggcggctgacggtccggcctatatacactgttta
tctgtttgccccactggctggcgttgtgctaccgaagatactattaagatagggcggctg
gcggttgagaccggtgttttccctctgtacgaggtcattaacggccagtacaagctgagc
atggaaaccccggagcttaagcctctacgggaatacaccagtcttcagcggcggttccgc
catcttacagaagaatctcttgaccttattcaggaaagagttcagctggaatacaataag
attgcagagagggcggcatgtgcaccgaaactagagaaatag

DBGET integrated database retrieval system