KEGG   Dehalococcoides mccartyi VS: DhcVS_649Help
Entry
DhcVS_649         CDS       T01136                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DhcVS_649 (tpiA)
   01230 Biosynthesis of amino acids
    DhcVS_649 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DhcVS_649 (tpiA)
   00051 Fructose and mannose metabolism
    DhcVS_649 (tpiA)
   00562 Inositol phosphate metabolism
    DhcVS_649 (tpiA)
Enzymes [BR:dev01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DhcVS_649 (tpiA)
Exosome [BR:dev04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DhcVS_649 (tpiA)
  Exosomal proteins of bladder cancer cells
   DhcVS_649 (tpiA)
  Exosomal proteins of melanoma cells
   DhcVS_649 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(607069..607824)
Genome map
AA seq 251 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACILVQSMKGELETIDGIEKIVCPPFISLSHIKTILENSSIK
LGAQNLFYEEKGAYTGEISPLMLKELCQYVIIGHSERREYFGETGQVVNQKIKAAIQAGI
LPIVCVGEKLEENEKGQTRQVLETQLKEALNGLSLSSIIIAYEPIWAIGTGKAATASAAN
AAICYIRKVLSEILGNTAARKSSILYGGSVNEKNTAELLSQSDIDGALVGGASLKADSFI
SICRQAAAISK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagattattattgccggtaactggaaaatgaataccactctttccgaagcttgt
atactcgtacaaagcatgaaaggtgaacttgaaacgatagacggcattgaaaaaatagtc
tgcccgccttttatatccctgagtcacataaaaaccatactagaaaatagcagcatcaag
ctgggtgcccaaaaccttttttacgaagaaaaaggggcatatacaggtgaaatatccccc
ttgatgctgaaagagctctgccaatacgtgattataggccactctgaaagacgggaatat
ttcggtgaaacaggacaggttgtcaaccaaaaaataaaagccgctattcaggctggcata
cttccgatagtatgtgtgggtgaaaaacttgaagaaaatgagaagggccaaacccgccaa
gtattggaaactcagctaaaagaggctttgaatgggcttagcctgagcagtatcataata
gcttatgaacccatttgggctataggcaccggcaaggctgccaccgcttcagcagccaat
gcggcaatctgttatatacgtaaggtattaagtgaaattctggggaacactgcagcccga
aaatcttccatactctatggaggcagtgtaaatgaaaaaaataccgccgaactcctctct
cagtcagatattgacggggcactggtaggcggagcttcactgaaggctgattcttttata
agcatttgccgccaagccgccgctatttcaaaataa

DBGET integrated database retrieval system