KEGG   Dehalococcoides mccartyi VS: DhcVS_905Help
Entry
DhcVS_905         CDS       T01136                                 

Definition
(GenBank) pyridoxal-phosphate dependent tryptophan synthase-like protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DhcVS_905
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DhcVS_905
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DhcVS_905
Enzymes [BR:dev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DhcVS_905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
838792..840159
Genome map
AA seq 455 aa AA seqDB search
MVQTKFILQEKDMPQVWYNIQPDLPVPLPPVLHPGTGQPVTPADMEAIFPMSLIMQEFSP
ERHIAIPEELLEIYKIWRPTPLYRAHRLEKALQTPAKIFYKLEDVSPAGSHKPNTALAQA
YYNKKAGIKRIATETGAGQWGSSLAMACKFFDIECKVYMVKVSYNMKPYRRIMMETWGAS
VVPSPSPDTKIGREILERDPECPGSLGIAISEAVEDAVTHPGTKYALGSVLNHVLLHQTI
IGQEAKKQMAMADCYPDIVIGCVGGGSNFGGIALPFVEDKLNGTHKNTRILAVEPASCPS
LTKGLDAYDFGDEAGMTPMMKMFTLGHRFMPPPVHAGGLRYHGMSPLLSHLSRLKLIEAT
AVNQVETFEAGMQFAQTEGFISAPETNHAIRATIDEALKCRETGEAKTILFCHSGHGHVD
MASYDLYLRGKLSNYEYPAELVKEAQKGLPKVNVK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaccaagtttatactgcaagaaaaggacatgcctcaggtctggtacaatatc
cagcctgatttgcccgtaccactgcctcccgttctgcatccgggtaccggccaaccggtg
actccagctgatatggaagccatattccccatgagccttattatgcaggaattcagtcct
gaaaggcatatcgccatacctgaagaactgctggaaatatataaaatctggcggccaact
cccctttaccgtgcccacaggctggaaaaagctttgcagaccccggctaaaatcttttac
aaactggaagatgtcagcccggccggttctcataaacccaacaccgctctggctcaggct
tattataataaaaaagccggcataaaaaggattgccaccgagaccggcgccggacagtgg
ggttcttcgctggctatggcctgcaaattctttgatatagagtgcaaggtctacatggta
aaggtcagctacaatatgaaaccctaccgccgcattatgatggaaacctggggtgcctct
gtcgtacccagccccagccctgataccaagataggccgtgaaatacttgaacgtgaccct
gaatgccccggcagcctgggtattgctataagcgaagccgtggaagacgccgtaacccat
cccggcaccaagtatgctttggggagtgtacttaaccacgttctgctgcatcagactatt
atcggtcaggaagccaaaaaacagatggctatggctgactgctacccggatatcgtgatt
ggctgcgtaggcggcggctctaacttcggcggtatagccctgccttttgtagaagacaaa
ttgaacggcactcacaagaatacccgaattctggctgttgaacccgccagctgcccttct
ctgaccaaaggtctggatgcttatgacttcggagacgaagctggtatgacacccatgatg
aaaatgtttaccttgggtcaccggttcatgccccctccggtacatgccggcggtttgcgc
tatcatggtatgtcacccttactgtctcacctcagccgcctgaagctgattgaggccaca
gctgttaaccaggtagaaacctttgaagctggcatgcagtttgcccaaaccgaaggcttc
ataagcgcacctgaaaccaatcacgccattagggcgaccattgatgaagctttgaaatgc
cgtgaaaccggcgaagccaaaaccatactcttctgccacagcggccatggccatgtggac
atggcttcttatgacctgtatctgcgcggcaagttgagcaattatgaatatcctgcagaa
ctggtaaaagaggctcagaagggtttacccaaagtaaacgtcaagtaa

DBGET integrated database retrieval system