KEGG   Dehalococcoides mccartyi VS: DhcVS_988Help
Entry
DhcVS_988         CDS       T01136                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DhcVS_988 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DhcVS_988 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DhcVS_988 (thrC)
Enzymes [BR:dev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DhcVS_988 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(920643..921689)
Genome map
AA seq 348 aa AA seqDB search
MKQGVIEHYRKYLPVTDKTPSITLGEGDTPLVRCPKLEKELGIAELYFKLEGCNPTGSFK
DRGMVMAVAKAIEDGFKAVVCASTGNTSASATAYAAASGLESIIIIPSGKIALGKLAQAI
VYGAKIIQIKGNFDQALQIVFKLTEKHKVALVNSVNPYRIEGQKTSAFEIVDALGKAPDF
LFIPVGNAGNITAYWKGFKEYHQLGKTTSLPKMMGFQAEGAAPIVRGHAIAEPETLATAI
RIGNPASWKKAEEARDQSGGIIAMVSDAEIMAAYHKMASAGIFGEPASAAPLAGLIKRIK
GGQDFSSSQVVCVVTGNGLKDSDIAIKGAGGFSETEASLGAVEKVLGW
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagggtgtcattgagcattaccggaaatatctgccggttacagataaaaccccc
tcaattacgctgggggagggtgatacgcctctggtgcgctgccccaagctggaaaaagaa
ctggggatagccgagctttatttcaagctggaaggctgtaatcccaccggctctttcaag
gaccggggcatggtcatggcggttgccaaggctatagaagacgggtttaaagcggtggtt
tgtgcttccaccggcaataccagcgcttcggctaccgcctatgcggctgccagcgggctt
gaatccattataattatcccgtccggcaaaatagccctgggcaagctggctcaagcaatt
gtctacggggcaaaaataatccagataaaaggcaactttgaccaagccctgcagatagtc
ttcaaactgactgagaagcacaaggtggcgctggttaactcggttaatccataccgtata
gaaggccagaaaacatctgcttttgagattgtagacgctttaggcaaagcgcctgacttt
ttgtttataccggtgggcaatgccggcaatattactgcctattggaaggggtttaaagaa
taccaccagctgggtaaaaccacttccctgcccaaaatgatgggttttcaggccgaaggg
gccgcccccattgtccgcggccatgctattgccgagcctgaaacactggccactgctatc
cgcataggtaaccctgcttcctggaaaaaggctgaggaagcccgagaccagtcaggcggg
attatagctatggtttcagatgccgaaataatggctgcttatcacaaaatggcatcagcc
ggtattttcggtgagccggcctctgccgcacctttggccgggttgataaaacgtattaag
ggcgggcaggatttttcctcaagccaggttgtatgtgtggttaccggaaacggccttaag
gacagcgatattgccataaaaggggcgggcggtttttccgaaaccgaagccagccttggg
gcagtggaaaaagtactgggctggtag

DBGET integrated database retrieval system