KEGG   Dehalococcoides sp. VS: DhcVS_992Help
Entry
DhcVS_992         CDS       T01136                                 

Gene name
acs
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dev  Dehalococcoides sp. VS
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dev01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dev00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dev00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dev00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dev00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925701..927659
Genome map
AA seq 652 aa AA seqDB search
MSTEEKKFDTQNLPTKTYFWPLKRYQDLYNSSLADPEAFWAKHSDVLSWEKPWEKVLDWN
PPYARWFVGGKLNMSYQCVDRHAKSWRKSKVAIYWEGENGDTQTISYSDLYENVNRYASV
LKKLGICKGDRVTVYLPMIPEMVYILLACNRVGAVHNVIFSGFSSQSIADRVNDSGSKMV
VTASGGHRRGKILPLKEIVDEAVKSTPTIEHVLVIKYTGHEVAMDPTRDVWAHDLLKDAD
KYVAPEAMESTDPLFILYTSGTTGKPKGILHGTGGYGVWACNTLKWAFKPTDESVFWCTA
DVGWITGHTYVVYAPLALGLTQVIYEGAPDYPSVDRWWEIIDKYGVSIFYTSPTAIRMFM
RHGEELPARHDLGTLEMLGSVGEPINPEAWEWYYKNIGHENCPISDTWWQTETGGFMITP
CPGIQSFPLKPGSATLPLPGVDPVVVDAEGKELPANETGFIAIRKPWPGIMLGIYNGDEL
YKKTYWSRFPGWYCPGDFSMKDSDGYLWLLGRADEVIKVAGHRISTAELEHALVGHSSVA
EAAVASRPDEVKGEAIVVFVTLKKGVEASAEVKRELTHHLRSAIGTIATPEEIIFVEKLP
KTRSGKIMRRLLKAVANEVPIGDTTTLDDETSVNEARAAFDELLAARKHHKH
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgaagaaaagaagtttgacacgcaaaacctgcctaccaagacttatttctgg
ccgctgaaaagataccaggacctttataacagctcactggctgacccggaggctttctgg
gccaaacactcagacgtgctttcatgggaaaagccttgggaaaaagtactggactggaat
ccgccttatgcccgctggtttgtaggcggcaagctgaatatgtcttaccaatgcgtagac
cgccatgccaaaagctggcgtaagagcaaggtagctatctattgggaaggcgaaaacggg
gatacccagaccataagctattcagacctttacgaaaatgtaaaccgttatgcatccgtc
ctgaaaaagctgggcatatgcaagggtgacagggtaactgtctacctgcccatgatacct
gaaatggtctatattctattagcctgcaaccgggttggagccgtccataacgtaatattc
tcaggtttctcttcccagtctatcgcagacagggtaaatgactccggttcaaaaatggtt
gttaccgccagcggcggacaccgccgcggtaagatactgcctcttaaagaaatcgtagat
gaggctgtaaaatccaccccgactatagaacatgtactggttattaaatataccggccac
gaagtagccatggaccccaccagagacgtatgggcacatgatctgctgaaagatgcagat
aaatacgtagcccctgaagctatggaatccaccgacccgctttttatcctgtacacctca
ggcactaccggtaaaccgaagggtattctgcatggtaccggcggctacggcgtctgggcg
tgcaatacccttaagtgggctttcaaacccacggacgaatcagtcttctggtgcacggca
gacgtaggctggattaccgggcacacatatgttgtatatgccccgctggcgctgggactt
acccaggttatttacgagggagctccggattatccttcagtagaccgctggtgggagatt
attgataaatacggggtaagcatattctatacctcgcctaccgccatacgcatgtttatg
cgccacggcgaggagttgcctgccagacacgaccttggcactctggaaatgctgggaagc
gtgggcgaacccattaaccctgaagcctgggaatggtattacaagaatataggccatgag
aactgccccatttccgatacttggtggcagaccgaaacaggcggttttatgattaccccc
tgccccggcatacaatccttcccgctcaaaccgggctcagccactttgcctctaccggga
gttgacccggtagtggtagatgctgaaggcaaggaactgccggctaatgaaaccgggttt
attgccatccgcaaaccttggccgggcataatgctgggtatatataacggtgatgaactt
tataaaaagacctactggagccgtttccccggctggtattgtccgggagacttttcaatg
aaagattctgacggatatctgtggctgctgggacgggctgacgaagttatcaaggtagcc
ggtcaccgcataagcaccgccgaattggagcatgctctggtaggccatagttcagttgcc
gaagcggcagtagcctcccgccctgacgaagtaaagggtgaagctattgtggttttcgtc
accctgaaaaaaggtgtagaagcctctgcggaagtaaagagagagcttacccatcacctc
cgctctgctatcggcactatagccaccccggaagagatcattttcgtggagaaactgccc
aaaacccgttcgggcaagattatgcgccgcctgctgaaggccgttgccaacgaagtaccc
attggtgataccactacacttgatgatgagacttcggtaaatgaggccagagcggctttt
gatgaactgctggcagcacgcaaacaccacaaacactaa

DBGET integrated database retrieval system