KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_00030Help
Entry
DFA_00030         CDS       T02668                                 

Definition
putative histone acetyltransferase
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Brite
Enzymes [BR:dfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DFA_00030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 469 aa AA seqDB search
MTTILKFDSNQSTNIKFVWTSHELVNYLERDQKQQQQQQQQDHQQHQQQDQQQIQNNFYR
INIHERDNRFAPFNTEFSHNFFKEEQIMGYDPLRLNIFFTAGSLYSFIDTNYTIKSRNIT
NVEKQITGFMSKTDPPFRSINQLQDVCSSSSSSSSSSSSSSSSSSSSSSSSSSSRVHLEN
KEKDFVPVGVKLKEYTIVDREIGEEMVYEIYFGRISDPAVLRYHERLQIFCLWFIDASSF
IHSNDTNWDVFFIFEKRMIDGQPRYGIAGYCTLYNFYHHPSQTRPRISQFLVLPPYQRMG
HGKHLFNSIYNYYLTNDSVYGPCYDLTVEDPGEQFSLLRNTVDLGNIMRSELFKDIQPNN
SLSLSANTLLFENIRKKLLISPSQSKICLEIYLLSKLMHMPSNSPVYKNYRISIKKKLYK
QYIGNEVDESIKDDPAKLKEAEESKKKILLELYRTTEQEYCQTIQSLGL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatattaaaatttgattctaatcaatcaaccaatatcaagtttgtgtggaca
tcacatgaacttgtaaactatcttgaacgagaccaaaaacaacaacaacaacaacaacaa
caagatcatcaacaacatcaacaacaagaccaacaacaaatacaaaacaacttttatcga
atcaatatacatgaaagagataataggtttgcaccttttaatacagagttttcacacaac
tttttcaaagaggaacaaatcatgggatatgatccacttagattaaacatattctttact
gctggtagtctctattcgtttattgatacaaactatactatcaaatctagaaatattaca
aatgtagagaaacaaattactggtttcatgtcaaaaactgatccaccttttagatcaatc
aatcaattacaagatgtatgtagtagtagtagtagtagtagtagtagtagtagtagtagt
agtagtagtagtagtagtagtagtagtagtagtagtagtagtagggtacatttagaaaac
aaagaaaaggattttgtaccagttggagttaaattaaaagaatatacaattgttgataga
gagattggagaagagatggtttatgaaatctattttggaagaatatcagatccagccgtt
ctgagatatcatgaaagactacaaatattctgtttgtggtttattgatgcatcgtcattt
attcactccaacgacaccaattgggatgtattttttatctttgaaaagagaatgattgat
ggacaaccacgatatggcatagctggctattgcactctatacaatttctatcatcatcca
tctcaaacacgtcctcgtattagtcaatttttggttttaccaccttatcaaagaatgggt
catggaaaacatttatttaattcaatttataattattatttaacaaatgatagtgtatat
ggaccatgttatgatttaacggttgaagatccaggtgaacaatttagtcttttacgtaat
actgtagatcttggtaacattatgcgttctgaattgtttaaagatattcaaccaaataat
tcactttcattatctgccaatactctactatttgaaaatatacgtaaaaaattattaatc
tctccatcacaaagcaaaatatgtttagaaatttatttattaagtaaattaatgcatatg
ccatcaaatagtccagtctataaaaactatagaatatcgattaaaaagaaattatataaa
caatacattggaaacgaagtagatgaaagtatcaaagatgatccagccaaattaaaagaa
gcagaagaaagtaaaaaaaaaatattgttggaattgtataggacaacagagcaagaatat
tgtcaaactattcaatcattgggactttaa

DBGET integrated database retrieval system