KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_00197Help
Entry
DFA_00197         CDS       T02668                                 

Gene name
glud2
Definition
NAD+ dependent glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:dfa00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dfa00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dfa00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:dfa00430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1030 aa AA seqDB search
MNQGLTISQEIAVQPAKTAVYFTSEDSNSLHALLEQNTFKQQAQEVKAILQNERLLEASR
VDPEVDWFYCKLGIDSNYFESTPAVVIARHILSLYAAKMVSHATGAKLEVQLQSKTEGSA
TFISPSNPGKRDSPAMLIEQYIESQYFGEGYHDETPQQQAPVTFATTLNSPKPPASLPPH
GYRLACYRTTGTVSSQSPVHLRLYYLTKPIFPQSETPVSTTEADLAKIGDLQFLERSSEA
TKKIYQEVMNEVVHKLGPVIKHYPYQTNGSRLVVAYRRGSTHSYWSAISELYHYHQMYAT
HKYVEQFSNGIVIYSIYLRPLKPEVDINTLIGKIAEQASIVYVLPRTSLTSLFLSHQLSF
PEVTYAYVGWKFAYQFLNRYATEYSALAQAIGDDSTKQSMLAQLKTRLSKDTFTEGRVRD
AIMQYPELIRQLYGDFEKFHFKGTKGGASKYDVEHGADIIHTIKRTVNNELDAQIFTAIL
QFNRHLLKTNFYKTTKTALVFRLDPGFLSKQEYQNTPFAVFFVVGSEFRGFHIRFRDIAR
GGIRVIRSQNMTQYDHNSSSLFDENYNLASTQQSKNKDIAEGGSKGTVLLSADHQSKAEV
AFRKYIDALVDVLLPNDEIVDHFGREEILFLGPDEGTADFMNWASEHAKQRGAHFWKAFT
TGKSLSKGGIPHDLYGMTTRSIHQYVLGTLAKLGRDESACTKFQTGGPDGDLGSNEIKIS
KDKTIGIVDGSGVLYDPVGLDRAEITRLAGKRQMGRYFDKSKLSAQGFFVDVQDNDVKLP
SGEIVESGLIFRNNFHLNPLSSADIFVPCGGRPESVQLVNVNTLFTNSGESRFPIIVEGA
NLFFTQKARLMLEEKGAIIFKDASANKGGVTSSSLEVLSALALNDDEFKEHMCVKDGQEA
PAFYQAYIKDVHHTIEENARLEFQCIWAEHEKTKTSRCILSDLISNKINHLNDAIQDSPL
WDNQSLKKRIISEACPKVLLNLLGVDKIIERVPVPYVKAIFGSYLASRFVYECGLSNSEF
AFYTFIQKLL
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaggattaaccattagtcaagagattgctgttcaaccagccaagacagccgta
tactttaccagcgaggatagtaatagcttgcatgcactgttggagcaaaacacattcaag
caacaagcacaagaggtcaaggcaatcctccaaaacgagcgtctgctcgaggcatcacgt
gtcgaccccgaagtcgactggttctactgcaagttgggtatcgacagcaactactttgag
tctacaccagctgttgtcattgcccgtcacatcctttcgttgtacgccgccaagatggtc
agtcacgccaccggcgccaaactcgaggtacaattgcaaagcaagaccgagggtagtgcc
acctttatctcaccatccaacccgggcaaacgtgactctccagccatgttgatcgagcag
tacatcgagtcacagtactttggcgaagggtatcatgacgagaccccacaacaacaagca
cccgtcacttttgccactactctcaactcgcccaaaccacctgcttccctgccaccccac
ggataccgtcttgcatgttaccgtaccaccggtaccgtgtcgagtcagtctcccgtccac
ctccgtctctactacctcaccaaacccatcttcccacaatccgagacacccgtctcgacc
accgaagccgatctcgccaagattggagatctccagttcctcgagcgttcctcagaggcc
accaaaaagatctaccaagaggtcatgaacgaggtcgtccacaagctcggcccagtcatc
aagcactacccctaccaaaccaacggctcgcgtctcgtcgttgcctaccgtcgtggatcc
acccactcctactggtctgccatctctgagctctaccactaccaccaaatgtacgccacc
cacaagtacgtcgaacaattctccaatggtatcgtcatctattccatctatctccgtccc
ctcaagcctgaagttgacatcaacacccttattggaaagattgctgaacaagcatcaatt
gtatatgtattaccaagaacatcacttacatcattattcttgtcacatcaattatcattc
ccagaggttacttatgcatatgttggatggaagtttgcctaccaatttttgaatcgttat
gcaacagagtatagtgcattggcacaggctattggcgacgattcgaccaagcagtcaatg
ttggcccaactcaagacacgtctctccaaggacacctttactgagggtcgtgtacgtgac
gccatcatgcaatacccagagttgatccgtcagttgtatggtgactttgaaaagttccat
ttcaagggtaccaagggaggtgctagcaagtacgacgttgagcacggtgccgacattatc
cacacgatcaaacgtaccgtcaacaacgagttggacgcccaaatctttaccgccatcctc
caattcaaccgtcatttgctcaagaccaacttttacaagaccaccaagactgcccttgtc
ttccgtctcgacccaggattcctctccaagcaagaataccaaaacaccccattcgcagtg
ttctttgtcgtcggttccgagttccgtggtttccacattcgtttccgtgatattgcacgt
ggtggtatccgtgtgatccgttcgcaaaacatgactcaatacgatcacaacagcagctcg
ttgtttgacgagaattacaatcttgcatcgacccagcagtccaagaacaaggacattgcc
gaaggtggcagcaagggcaccgtgctcctgtcggccgaccatcagtccaaggccgaggtc
gccttccgcaagtacattgacgcgttggtcgacgtgttgttgcccaacgacgagattgtc
gatcattttggtcgtgaggagatcctcttcctcggaccagacgaaggtactgccgacttt
atgaactgggcatctgagcatgccaagcaacgtggtgcacatttctggaaggcctttacc
accggcaagagtctgtccaagggtggtatcccacacgatctctacggtatgactactcgt
tccatccatcaatatgtacttggtacactcgccaagctcggccgtgacgagagcgcctgc
accaagttccaaacgggtggtccagacggtgacctcggatccaacgaaatcaagatatcc
aaggacaagacgatcggcattgtcgacgggtccggagtactctacgatccagtcggtttg
gaccgtgcagagatcactcgtcttgccggcaagcgtcagatgggccgttactttgacaag
tccaagttgtcggcccaaggcttctttgtcgacgttcaagacaacgacgtcaagttgccc
agcggcgagattgtcgagagtggcttaatcttccgtaacaacttccatctcaacccattg
tcgtcggccgatatctttgtgccatgcggcggtcgtcccgagtcggtccaactcgtcaac
gtcaacacgttgttcaccaacagcggcgaatcacgtttcccaatcatcgtcgagggtgcc
aacctcttctttacgcaaaaggcccgtctcatgctcgaagaaaagggcgccatcattttc
aaggacgcctcggccaacaagggaggtgtcacctcgtcttcgctcgaggtgctctctgcg
ctcgcactcaacgacgacgagttcaaggaacacatgtgtgtcaaggacggccaagaggcc
cccgccttttaccaagcctacatcaaggacgtgcaccacaccatcgaagagaatgcccgt
ctcgagttccagtgtatctgggccgagcatgaaaagacaaagacctcgcgttgcatcctc
tcggatctcatctccaacaagatcaaccacctcaacgacgccatccaagactcgccactc
tgggacaaccagtcgctcaagaagcgtatcatctcagaggcctgtcccaaggttctcttg
aatctcttgggtgtcgacaagatcatcgagcgtgtccccgtcccatacgtcaaggccatc
tttggcagctacctcgcctctcgtttcgtctatgaatgtggtttgtccaattctgaattt
gctttttatacctttattcaaaaattactctaa

DBGET integrated database retrieval system