KEGG   Cavenderia fasciculata (cellular slime mold): DFA_00197Help
Entry
DFA_00197         CDS       T02668                                 

Gene name
glud2
Definition
(RefSeq) NAD+ dependent glutamate dehydrogenase
  KO
K15371  glutamate dehydrogenase [EC:1.4.1.2]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00220  Arginine biosynthesis
dfa00250  Alanine, aspartate and glutamate metabolism
dfa00430  Taurine and hypotaurine metabolism
dfa00910  Nitrogen metabolism
dfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    DFA_00197 (glud2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DFA_00197 (glud2)
   00220 Arginine biosynthesis
    DFA_00197 (glud2)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DFA_00197 (glud2)
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     DFA_00197 (glud2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog Bac_GDH ELFV_dehydrog_N
Motif
Other DBs
NCBI-GeneID: 14871758
NCBI-ProteinID: XP_004357913
UniProt: F4PXV9
Position
Unknown
AA seq 1030 aa AA seqDB search
MNQGLTISQEIAVQPAKTAVYFTSEDSNSLHALLEQNTFKQQAQEVKAILQNERLLEASR
VDPEVDWFYCKLGIDSNYFESTPAVVIARHILSLYAAKMVSHATGAKLEVQLQSKTEGSA
TFISPSNPGKRDSPAMLIEQYIESQYFGEGYHDETPQQQAPVTFATTLNSPKPPASLPPH
GYRLACYRTTGTVSSQSPVHLRLYYLTKPIFPQSETPVSTTEADLAKIGDLQFLERSSEA
TKKIYQEVMNEVVHKLGPVIKHYPYQTNGSRLVVAYRRGSTHSYWSAISELYHYHQMYAT
HKYVEQFSNGIVIYSIYLRPLKPEVDINTLIGKIAEQASIVYVLPRTSLTSLFLSHQLSF
PEVTYAYVGWKFAYQFLNRYATEYSALAQAIGDDSTKQSMLAQLKTRLSKDTFTEGRVRD
AIMQYPELIRQLYGDFEKFHFKGTKGGASKYDVEHGADIIHTIKRTVNNELDAQIFTAIL
QFNRHLLKTNFYKTTKTALVFRLDPGFLSKQEYQNTPFAVFFVVGSEFRGFHIRFRDIAR
GGIRVIRSQNMTQYDHNSSSLFDENYNLASTQQSKNKDIAEGGSKGTVLLSADHQSKAEV
AFRKYIDALVDVLLPNDEIVDHFGREEILFLGPDEGTADFMNWASEHAKQRGAHFWKAFT
TGKSLSKGGIPHDLYGMTTRSIHQYVLGTLAKLGRDESACTKFQTGGPDGDLGSNEIKIS
KDKTIGIVDGSGVLYDPVGLDRAEITRLAGKRQMGRYFDKSKLSAQGFFVDVQDNDVKLP
SGEIVESGLIFRNNFHLNPLSSADIFVPCGGRPESVQLVNVNTLFTNSGESRFPIIVEGA
NLFFTQKARLMLEEKGAIIFKDASANKGGVTSSSLEVLSALALNDDEFKEHMCVKDGQEA
PAFYQAYIKDVHHTIEENARLEFQCIWAEHEKTKTSRCILSDLISNKINHLNDAIQDSPL
WDNQSLKKRIISEACPKVLLNLLGVDKIIERVPVPYVKAIFGSYLASRFVYECGLSNSEF
AFYTFIQKLL
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaggattaaccattagtcaagagattgctgttcaaccagccaagacagccgta
tactttaccagcgaggatagtaatagcttgcatgcactgttggagcaaaacacattcaag
caacaagcacaagaggtcaaggcaatcctccaaaacgagcgtctgctcgaggcatcacgt
gtcgaccccgaagtcgactggttctactgcaagttgggtatcgacagcaactactttgag
tctacaccagctgttgtcattgcccgtcacatcctttcgttgtacgccgccaagatggtc
agtcacgccaccggcgccaaactcgaggtacaattgcaaagcaagaccgagggtagtgcc
acctttatctcaccatccaacccgggcaaacgtgactctccagccatgttgatcgagcag
tacatcgagtcacagtactttggcgaagggtatcatgacgagaccccacaacaacaagca
cccgtcacttttgccactactctcaactcgcccaaaccacctgcttccctgccaccccac
ggataccgtcttgcatgttaccgtaccaccggtaccgtgtcgagtcagtctcccgtccac
ctccgtctctactacctcaccaaacccatcttcccacaatccgagacacccgtctcgacc
accgaagccgatctcgccaagattggagatctccagttcctcgagcgttcctcagaggcc
accaaaaagatctaccaagaggtcatgaacgaggtcgtccacaagctcggcccagtcatc
aagcactacccctaccaaaccaacggctcgcgtctcgtcgttgcctaccgtcgtggatcc
acccactcctactggtctgccatctctgagctctaccactaccaccaaatgtacgccacc
cacaagtacgtcgaacaattctccaatggtatcgtcatctattccatctatctccgtccc
ctcaagcctgaagttgacatcaacacccttattggaaagattgctgaacaagcatcaatt
gtatatgtattaccaagaacatcacttacatcattattcttgtcacatcaattatcattc
ccagaggttacttatgcatatgttggatggaagtttgcctaccaatttttgaatcgttat
gcaacagagtatagtgcattggcacaggctattggcgacgattcgaccaagcagtcaatg
ttggcccaactcaagacacgtctctccaaggacacctttactgagggtcgtgtacgtgac
gccatcatgcaatacccagagttgatccgtcagttgtatggtgactttgaaaagttccat
ttcaagggtaccaagggaggtgctagcaagtacgacgttgagcacggtgccgacattatc
cacacgatcaaacgtaccgtcaacaacgagttggacgcccaaatctttaccgccatcctc
caattcaaccgtcatttgctcaagaccaacttttacaagaccaccaagactgcccttgtc
ttccgtctcgacccaggattcctctccaagcaagaataccaaaacaccccattcgcagtg
ttctttgtcgtcggttccgagttccgtggtttccacattcgtttccgtgatattgcacgt
ggtggtatccgtgtgatccgttcgcaaaacatgactcaatacgatcacaacagcagctcg
ttgtttgacgagaattacaatcttgcatcgacccagcagtccaagaacaaggacattgcc
gaaggtggcagcaagggcaccgtgctcctgtcggccgaccatcagtccaaggccgaggtc
gccttccgcaagtacattgacgcgttggtcgacgtgttgttgcccaacgacgagattgtc
gatcattttggtcgtgaggagatcctcttcctcggaccagacgaaggtactgccgacttt
atgaactgggcatctgagcatgccaagcaacgtggtgcacatttctggaaggcctttacc
accggcaagagtctgtccaagggtggtatcccacacgatctctacggtatgactactcgt
tccatccatcaatatgtacttggtacactcgccaagctcggccgtgacgagagcgcctgc
accaagttccaaacgggtggtccagacggtgacctcggatccaacgaaatcaagatatcc
aaggacaagacgatcggcattgtcgacgggtccggagtactctacgatccagtcggtttg
gaccgtgcagagatcactcgtcttgccggcaagcgtcagatgggccgttactttgacaag
tccaagttgtcggcccaaggcttctttgtcgacgttcaagacaacgacgtcaagttgccc
agcggcgagattgtcgagagtggcttaatcttccgtaacaacttccatctcaacccattg
tcgtcggccgatatctttgtgccatgcggcggtcgtcccgagtcggtccaactcgtcaac
gtcaacacgttgttcaccaacagcggcgaatcacgtttcccaatcatcgtcgagggtgcc
aacctcttctttacgcaaaaggcccgtctcatgctcgaagaaaagggcgccatcattttc
aaggacgcctcggccaacaagggaggtgtcacctcgtcttcgctcgaggtgctctctgcg
ctcgcactcaacgacgacgagttcaaggaacacatgtgtgtcaaggacggccaagaggcc
cccgccttttaccaagcctacatcaaggacgtgcaccacaccatcgaagagaatgcccgt
ctcgagttccagtgtatctgggccgagcatgaaaagacaaagacctcgcgttgcatcctc
tcggatctcatctccaacaagatcaaccacctcaacgacgccatccaagactcgccactc
tgggacaaccagtcgctcaagaagcgtatcatctcagaggcctgtcccaaggttctcttg
aatctcttgggtgtcgacaagatcatcgagcgtgtccccgtcccatacgtcaaggccatc
tttggcagctacctcgcctctcgtttcgtctatgaatgtggtttgtccaattctgaattt
gctttttatacctttattcaaaaattactctaa

DBGET integrated database retrieval system