KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_00387Help
Entry
DFA_00387         CDS       T02668                                 

Gene name
uch2
Definition
peptidase C12 family protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Brite
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DFA_00387 (uch2)
Peptidases [BR:dfa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   DFA_00387 (uch2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 349 aa AA seqDB search
MSGNDGWCTIESDPGVFTELIENMGVKDVQVEELYSLDASEFSKLKPVYGLVFLFKWDGK
HYSSSQEPCDNQELFFAKQVINNACATQAILSILMNNKDIEMSDELTNFKDFCKFLMPED
RGDAIGNCDAIKRAHNSFARPESFDFESKGGKKEDAFHFVSYIPFEGKLYELDGLSRGPI
CHGECDDETWLELVQPIIQQRIAKYTSDEIRFNLMAVVKNRKKILSNQKNYLEGKKNAIL
LKLSQFDTAVTAMDIDESAFIKYNLPTTKEELDLLLAEMDEHLETIDQNIMMEDEKFRNW
REENIRRKHNYIPFIIKLLQILAERQELIPLINKAKAATASVDSQQRKK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaacgatggatggtgtacaattgaaagtgacccaggtgtctttacagagttg
atagagaatatgggtgttaaagatgttcaagttgaggaactttattctttagatgcttct
gaattctcaaagttaaaacctgtatatggtttagtatttttattcaaatgggatggtaaa
cactattcctcaagtcaagaaccatgtgataatcaagagttattctttgccaaacaagtg
attaataatgcatgtgcaactcaagctattctatccattttgatgaataataaggatatt
gaaatgagtgatgaattgacaaactttaaagatttctgtaaatttttaatgccagaggat
agaggagatgcaattggtaattgtgatgcaatcaagagagctcataatagttttgcaaga
ccagaatcatttgactttgaatcaaagggaggtaaaaaggaagatgcattccattttgtc
agttatatcccatttgaaggaaagttgtatgaattggatggtttgagtagaggaccaatt
tgtcatggtgaatgtgatgatgaaacttggttggaattggttcaaccaatcattcaacaa
agaatcgcaaagtatacatcggatgaaattagatttaatttaatggctgttgtaaagaac
cgtaaaaagatattatccaaccaaaagaactatttggagggtaaaaagaatgccatcctt
ttgaaattatctcaatttgatactgctgttacagccatggacatagatgaatctgcattt
atcaaatataatctaccaactaccaaagaagaattggatctattattggctgaaatggat
gaacatcttgaaaccatagatcaaaatattatgatggaagatgaaaagtttaggaattgg
agagaggaaaatattagaagaaaacataattatattccatttattattaaacttttacaa
attttagcagagagacaagaattaattccattaattaataaggctaaagctgcaactgct
tctgttgattctcaacaaagaaaaaaatag

DBGET integrated database retrieval system