KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_00614Help
Entry
DFA_00614         CDS       T02668                                 

Definition
histone deacetylase family protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Brite
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     DFA_00614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 491 aa AA seqDB search
MKIVILLSKLCASFYVLKREIEMSKKKVSYFYDSEVGNHYYGQNHPMKPHRIRMTHNLIL
NYGIYKKLQIFRPKKATEADLSNFHSDDYVNFLRLITPDNMHEYSKQLMKYNVRYDCPVF
DGMYNLCQISSGGSIGCAVKLNNKDSDIAVNWAGGLHHAKKSESSGFCYTNDIVLCILEL
LKHHKRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGDYFPGTGDVRDVGASKGKYYA
LNFPLKDGIDDQSYQSVFRPVIQSVMDSYRPEAVVLQCGADSLTGDRLGCFNLSLKGHAQ
CVEFMKSFNLPLVILGGGGYTIKNVARCWTYETSILVDHELPDELPYNDYLEYYGPDYRL
HITPNNMENQNSKDYLEKLKIQILENLRHLQHAPSIAHTEIPPDSYSYSDDEDDEDPDVR
ISESDRDRRVTNPGELSDSDEEDGRRHEMNGLDSTPSSRRRNQVPITAYDKEATNYKSYG
RNNQMDDEMME
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtgatcctcctttcaaagctttgtgcctctttctatgttttaaagagagaa
atagagatgagcaagaagaaagtatcatatttctatgattctgaagtaggtaatcactac
tatggtcagaatcatccaatgaaaccacacagaattagaatgacacataacttgatctta
aattatggcatatacaaaaagttacaaatctttagacctaaaaaagcaactgaagctgat
ctttcaaactttcattcagatgactatgttaactttttaagattgatcactcctgataac
atgcatgaatactctaaacaattgatgaagtataatgttagatatgattgcccagtattt
gatggaatgtataatttatgtcaaatctcttcgggtggttcgattggatgtgcagtaaag
ttaaacaacaaagattctgatattgctgtcaattgggccggaggtttacatcatgcaaag
aaatcagaatcttctggtttttgttataccaatgatattgtattatgtattcttgaatta
ttaaaacatcataaaagagtattatatattgatattgatattcatcatggtgatggtgta
gaggaagctttttatacaacagacagagtcatgactgtttcctttcacaaatatggtgat
tatttccctggtactggcgatgtaagagatgttggtgctagtaagggtaaatactatgct
ttgaatttccctctaaaggatggtattgatgatcaaagttatcaaagtgttttcagacct
gtaattcaatcagttatggattcatatagaccagaagcagttgtattacaatgtggtgca
gattcattgactggagatcgtttgggatgtttcaatctttcgttaaagggtcatgcccaa
tgtgtagaatttatgaagtcatttaatcttcctcttgtcattctcggtggtggaggttat
actatcaagaatgttgctagatgttggacttatgaaacttcaattttagttgatcatgaa
ttacctgatgaattaccatataatgattatttagaatattatggaccagattatagatta
catattacaccaaataatatggagaatcaaaattcaaaggattatcttgaaaaattaaag
attcaaattttagagaatctaagacatttacaacatgcaccaagtattgctcatactgaa
atcccacctgacagttatagttactctgatgatgaagatgatgaagatcccgacgttcgt
atcagtgagtcggaccgtgatagacgtgttacaaatccaggtgaattgtcagactcggat
gaagaagatggaagaagacatgaaatgaatggtttggattcaacaccatcctctcgtaga
agaaatcaagtaccaatcactgcctatgataaagaagcaaccaattataaatcatatggt
agaaataaccaaatggatgatgaaatgatggaataa

DBGET integrated database retrieval system