KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_01273Help
Entry
DFA_01273         CDS       T02668                                 

Gene name
agl
Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dfa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1535 aa AA seqDB search
MIEPDLLNKNNNSSSSNTKSNNNNSNSNNNNNVNNSMKSLNINNNNESQQQQQSLSANQQ
IYSITLTGNGSEPPFSAKGMVLDELGVLRIIIPSGLEVAASNPIIYSNYPNNPTDTFKRD
QFAPFQTGNIKHEYYGNNDLIFEKKIERYGCFDYYVEWTDRMGKTVKKGTIGTFQINTTL
LINAKEVSGDGIVMQTVLTKCMGAIDQWESHINMIDLVWNHTANNSHWLKDHPEAGYNID
NSPHLKAAITLDDAFMEFSEKNVGMHVESAEELELLVAKIKDHVIAPLKLWEFYVLDIEK
ELDIFSSAYPASVPPVDPNQPPASPYLPMSPKNMNESAYLVDNIFKKGMVRDPTYDRYSM
HIDLNHTFQLLNNTASFKPLTLIEKKQKYEDYLRLVNLTLYREYDTDLAAIVQNITERIK
YERIAPHGPKLGEVSTRHPLIDSYFTKVDHRQADGSQRKLHLANNGWIFNYNPAIDFASK
DSKAYLRRDVIIWGDCVKMRYGSAPADNPWLWDHMRQYTERMASIFHAIRIDNCHSTPIH
VAQYLLDIARAVRPSIYVTCELFTGSEDADSVFVKRLGINSLIREAMVAHDSSELGRVCH
RYGGRPICSFESIPPSSNDNNAINFTNNQIGVKSLKPTLPPALFMDCTHDNQTPAQKRTI
KDTLPNAAIVAMTVSAIGSTRGYDEIYPHTIDLVNEKRIYQVQNDINNGIQPLKSLLNNL
HLELSNNKYTEVHIHQEHNVILVQRFSPSLNKSIFLLAHTCFSEQKPEDIKLPDVIQIPC
KLTEFICGANITNSYQDHWNRDQNYLTGVHLDVDTRYGDRVYEKYCYVESEYNLHHNLHL
KLKEFPPGSILLFRGEIPKECNQAINQLNGVLEERKKLEQTLEKVSLIDLNILIFRHHDE
EKAVGGGGYNVANFGFLPYCGLQGFATILNQVSEWNDLGHPLCNNIREGDWAMDYIVQRL
LVSGRNNLQGIAKWLADCFVLVKRLPRHFIPKYFHQVVTIAYRAAVDKAITLMSPFVNSR
ESSWFVRALALSSLEFYGTVTPLIAHHPEVTDPFGPDGNASMAAGLPHFCAGYMRAWGRD
TFISLRGLMLTTGRLDEAKQLIIGFASSLRFGLIPNLLDSGTRPRYNSRDSVWWWIKSVQ
DYCEMGGEVRANDMLNYRVFRIFPNDQSSPYSTVHDILHEIMQSHARGIHFREPHAGREI
DDRMKDEGFNVDIDINPATGFLYGGNLYNCGTWMDKMGESTKARNYGDPATPRDGAPIEI
TAMVYVTAKWLAAINKTGQFKYASVKLGADEKIEWTYSQWADTIKANFEKQYYIPSSSDD
KKYNINSSFVRRRYIYKDTVGSKNSYSDYQFRPNQLVAMAFAPELFTRDYVLRTLDITKQ
SLIGPLGVRTLDPNDTDYHANYNNSLDNDYRPTAKGFNYHNGPEWLWLYGFFLESLVKFN
HLYPSTPNQSLSPSPIPSPLIISPSSSLISMTHLVESFLQRHKSYILQSSYFSLPELTNR
DGAHCRDGCDAQAWSIATLLASLNVLFQQKQQIHH
NT seq 4608 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacctgatctcttaaacaagaataataatagtagtagtagtaatactaaaagt
aataataataatagtaatagcaataacaataataatgtcaataatagtatgaagagttta
aatatcaacaataataatgaatctcagcaacagcaacagtcattgtctgctaatcagcag
atttattctataacattgactggaaatggttctgaaccacccttttctgccaaaggaatg
gtgttggatgaattgggtgtgttacgtatcatcatcccaagtggtctcgaagtagctgcc
tctaaccctatcatctattccaactatcccaataacccaactgacacctttaaacgtgat
caatttgctccattccaaactggaaatattaaacatgaatattatggtaataatgattta
atatttgaaaagaagattgaaagatatggatgttttgattattatgttgaatggactgat
agaatgggtaagactgtcaagaagggtactattggtacattccaaatcaacactacgctt
ttgatcaacgccaaagaggtgagtggtgatggtattgtgatgcagaccgtgttgaccaag
tgtatgggtgctattgaccaatgggagtcgcatatcaatatgatcgacctcgtgtggaac
catactgccaacaacagccattggctcaaggaccacccagaggctggctacaacattgac
aactcgccacacctcaaagctgccatcacactcgacgacgcctttatggagtttagtgaa
aagaatgtcggcatgcatgtcgagagtgcagaagagttggagttgctcgtcgccaagatc
aaggatcatgtgattgcaccactcaagttgtgggagttctacgtcctcgatattgaaaag
gagttggatatcttctcgtcggcataccccgcatcggtgccacccgtcgatcccaaccaa
ccacccgcctcaccgtatctacccatgtcgccaaagaacatgaacgagtcggcctacttg
gtggacaatatctttaaaaagggtatggtgcgcgaccccacctacgaccgttactcgatg
cacattgacctcaaccacaccttccagttgctcaacaacactgcctcgtttaaacctctc
acactcattgaaaagaagcaaaagtatgaagactatttgcgtctcgtcaacctcacgctc
taccgcgagtatgataccgatctagcagccattgtacaaaacatcactgaacgtatcaaa
tacgagcgtattgctccccacggacccaagcttggcgaggtgtcgacacgccacccactc
atcgactcgtactttacaaaggtcgatcaccgtcaagccgatggcagccaacgcaagcta
catcttgccaacaatggatggattttcaattacaacccagccattgattttgccagcaag
gatagtaaagcctatttgagacgtgatgttatcatttggggtgactgtgtcaagatgcgt
tatggtagtgctccagccgacaacccttggctctgggatcacatgcgtcaatacactgaa
cgcatggcatctattttccacgccattcgtattgacaattgtcactctactccaatccac
gttgcccaatatcttttagacattgcccgtgcagttcgtccatccatctatgtgacatgc
gagctctttacaggctctgaagacgccgactctgtatttgtcaaacgtcttggtatcaac
tcactcattagagaagcaatggttgcacatgacagtagtgagttgggaagagtttgtcat
cgttatggtggtcgtccaatctgttcatttgagagtattccaccatcgagcaacgataac
aatgccatcaactttaccaacaatcaaattggtgtaaagtcactcaaaccaacccttcca
ccagctctctttatggattgtacccatgacaatcaaacacctgctcaaaagcgtaccatc
aaggataccctaccaaatgctgccattgtagcaatgaccgtatctgctattggtagtact
cgtggttatgatgaaatctatcctcatacaattgatttggtcaatgaaaaacgtatctac
caagttcaaaatgatattaataatggtattcaacctttaaaatctttattaaataattta
catcttgaattatcaaataataaatatacagaagttcatattcatcaagaacataatgta
atattggtacaaagattttctccatcattaaacaaatcaatatttttacttgctcataca
tgtttttcagaacaaaaaccagaagatattaaattaccagatgtaattcaaattccttgt
aaattaacagaatttatttgtggagcaaatataacaaattcatatcaagatcattggaat
agagatcaaaattatttgactggagttcatttagatgttgatactagatatggcgataga
gtttatgaaaaatattgttatgttgaatctgaatataatttacatcataatcttcatcta
aaattaaaagaattcccaccaggatcaatattattatttagaggagaaataccaaaagaa
tgtaatcaagcaattaatcaattgaatggagttttggaggaaagaaagaaattggaacaa
actcttgaaaaggtatcattgattgatttgaatattcttattttcagacatcatgatgag
gaaaaggcagttggaggtggtggatacaatgtagccaactttggattccttccctattgt
ggtttgcaaggatttgccactattctaaaccaagtatctgaatggaatgatcttggtcac
cctctatgcaataatattagagaaggtgattgggcaatggattatatcgttcaacgtctt
ttggtgagtggtcgtaacaatctccaaggtattgccaaatggttggctgattgtttcgta
cttgtcaaacgtttaccaagacactttatccccaaatactttcatcaagtcgttactatt
gcctatcgtgccgctgtggacaaggcaatcactctgatgtcaccatttgtcaatagtcgt
gaaagttcatggtttgttcgtgctttggcattgtcgtcactcgagttttatggtacagtc
acaccattgattgctcaccatccagaggtaactgatccatttggacctgatggaaatgca
tcaatggctgcaggattaccacacttttgcgctggctatatgcgtgcatggggaagagat
acattcatctctttacgtgggctcatgttgacaaccggtcgactagacgaggccaagcaa
ctgatcattggatttgcttcgagcttgcgattcggtctcattcccaatctactagacagt
ggtacacgtccacgttacaactctagagacagtgtctggtggtggatcaagagtgtccaa
gactattgtgagatgggcggtgaggtacgtgccaacgacatgctcaactatcgcgtgttc
cgtatcttccccaacgaccagtcctccccctactctacagtacacgacattttacacgag
attatgcaatcacatgcccgtggtattcactttagagaaccacatgctggtcgtgagatt
gacgatcgtatgaaggacgagggattcaatgtagatattgacattaatccagccactgga
ttcctctatggtggaaacctgtacaactgtggaacatggatggacaagatgggagagtcg
accaaagcaagaaactatggtgaccccgccaccccaagagacggtgcacctattgaaatc
accgccatggtctatgtcactgccaagtggctcgcagccatcaacaagacgggccaattc
aagtatgccagtgtcaagttgggagccgacgaaaagatcgagtggacctattctcaatgg
gcagatactatcaaggccaactttgaaaagcaatactatatcccatcgtcatctgacgat
aaaaagtataatatcaactcgtcatttgtacgtcgccgttatatctacaaggatactgtt
ggctcaaagaactcttattccgactatcaattccgtccaaatcaattggttgctatggca
tttgcaccagagctctttaccagagactatgtattgcgtacactagacattacaaagcaa
tcgcttatcggaccacttggagtacgtacacttgatccaaacgatacagactatcacgcc
aactataacaactcgttggataatgactatcgtccaactgccaagggattcaactatcac
aacggaccagaatggctatggctctatggtttcttcctcgagtctcttgtaaagtttaac
catctctacccatccactcccaaccaatcactatctccatcccccatcccatctcctcta
attatatccccatcttcatccctcatatccatgacccatttggttgaatcattcctccaa
cgtcacaaatcctatattcttcaatcatcttacttttctcttccagagttgaccaaccgt
gatggtgcccactgtcgtgatggttgtgatgctcaagcttggtctattgctactttattg
gcttctcttaacgttttatttcaacaaaaacaacaaattcatcattaa

DBGET integrated database retrieval system