KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_01299Help
Entry
DFA_01299         CDS       T02668                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DFA_01299
Enzymes [BR:dfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DFA_01299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 919 aa AA seqDB search
MSNNTVHIRFKVNYYTRLGQEVYICGSSEELGNWVDAEAKKLRYGDNGDWEIIVEFKKTS
TDQVLNYKYFIMDTNADKIWEGGPNRTLDVSICDPFYTHEVRDTYQSPSSAENTFLKSSF
FRDVYFRRTPEDVKTYNHIPTNSKDKVVVRFQVKSTCVTPHHSVYIVGSNTTLGNWRTER
AIRLADDNYPNWRVDLEFTKDQLPFSYKYIITDDTTKSHVHWEQGSDRWFTSSILHASDY
SNAVNEDRVYFFNDGDFKESNLIRTSGVAVPVFSLRSKKGLGVGEFNDIKALIDWASATG
MHMIQILPINDTSVYYTWRDSYPYSSVSVFALHPIYINIESVSSDPEILSIINQHRDKLN
ALPHIDYESVITLKLDLLNKIYGKEKSKLATDKGLFEFVQENAKWIKPYALYMVLREQFK
SSDHFSWPEHKSIDKETIEKLTSKNEKYWEKVQFYYFVQYHLHLQLLSASRYAVENRIGL
KGDLPIGVSRQSVDTWVEPELFRLNMSTGAPPDAFADDGQNWGFPTYDWDRMKLDNYGWW
RARLGQMSKYFHAYRIDHILGFFRIWEIPTEQLTGLLGHFNPSLPLWRSELSNNGIWDLD
RLTKPYIRYHTLREQFGEYSDTVAKKFLKEYSPNCFKLLPQFETERLIDTNLEKDDQMYK
PGLLKLVQNVSLLKDQDDENRYYPRIEINKTTSFNELSDDLKATLYRMYISYYFERQEEL
WTQIGMQRLPAIRDCTRMLVCGEDLGMVPKCVEPTLKNLGILGLRIQRMPSESAKEFYHP
SEYSYLTVNTTSSHDMSTLRGWWEEDRTRSQNFYNNILGMYGEAPYFCEPYVTEAVIVQH
LQSQSMISIFPLQDWFGLSSELSSRDPKEEKINEPSNPFHYWRYRCHVNLEDLLENQEFN
KTIQRLIISSNRKLEDTNN
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataatacagtacacattagattcaaggtgaactattacactcgattgggtcaa
gaagtttacatttgtggatcatctgaagaattgggcaattgggtagatgcagaagcaaag
aagttgagatatggagacaatggtgattgggagattatcgttgaattcaaaaagacttct
actgatcaagtactcaactacaagtactttatcatggacactaatgctgacaagatttgg
gaaggtggtccaaatcgtactcttgacgtttcaatctgtgatccattctatactcatgaa
gttagagatacctatcaaagtccatcatctgctgaaaatactttcctcaaatcatcattc
tttagagatgtttatttcagacgtacaccagaagatgttaaaacttacaatcatattcca
actaattcaaaggataaagtagtagttagattccaagtaaagagtacatgtgttacacca
catcattcagtttatattgttggtagtaatacaacacttggtaattggagaacagaacgt
gctattcgattggccgacgacaattatccaaattggcgtgtcgaccttgaatttacaaag
gatcaactcccattctcctacaaatacattatcactgacgacacgaccaagtcacacgtg
cattgggagcaaggaagcgaccgttggtttaccagcagcattttgcatgcctctgactac
tcaaacgccgtcaatgaggaccgtgtctactttttcaacgatggtgatttcaaggaatcc
aacttgatcagaacctctggtgtagccgtaccagtgttttcacttcgttccaaaaaaggt
ctcggtgttggtgaattcaacgatatcaaggcactcattgactgggcctctgccactgga
atgcacatgatccaaattcttccaatcaacgatacctctgtctattacacatggcgtgac
tcttatccatacagttcagtatctgtatttgctcttcacccaatctatatcaacattgaa
tctgtctctagtgatccagaaattctatcaatcatcaatcaacatcgtgataaattaaat
gctttaccacatattgattatgaatctgttattacattaaaattagatttattaaataag
atttatggaaaggaaaaatcaaaacttgcaactgataagggtctttttgaatttgttcaa
gaaaatgccaaatggattaaaccatacgcactttacatggtattgagagaacaattcaaa
tcttctgatcatttctcttggccagaacataaatcaattgataaagaaacaattgaaaaa
ttaacatcaaagaatgaaaagtattgggaaaaggtacaattttattactttgttcaatac
catttacatttacaattattaagtgcatcgagatatgcagttgaaaatcgtattggtctc
aagggtgatctaccaattggtgtaagcagacaaagtgttgacacttgggtagaaccagag
ttgttccgtttgaacatgtcaactggtgccccaccagatgcctttgccgatgatggtcaa
aactggggattcccaacctatgattgggacagaatgaagttggacaattatggttggtgg
agagctcgtcttggtcaaatgtcaaagtatttccatgcctatcgtatcgatcatatcttg
ggtttctttagaatttgggaaatcccaactgaacaattaactggtctcttgggtcacttt
aatccatccctcccattatggagatctgaattatcaaataatggtatttgggatcttgat
agattaaccaaaccatatattagatatcatactttacgtgaacaatttggtgaatattca
gatacagttgcaaagaaattcttaaaagaatattctcccaattgttttaaattattacca
caatttgaaactgaaagacttattgatacaaaccttgaaaaagatgatcaaatgtataaa
ccaggattattaaaattagttcaaaatgttagtttattaaaggatcaagatgatgagaat
agatactatccgagaattgaaatcaacaagactacatcatttaatgaattgtcagatgat
ttaaaggcaactctctaccgtatgtacatctcgtactactttgaaagacaagaggagctt
tggactcagatcggtatgcaacgtttgccagctatccgtgactgcaccagaatgttggtt
tgtggtgaggatcttggtatggtaccaaagtgtgtagagccaaccctcaagaaccttggt
atcctcggtttgcgtatccaacgtatgccatccgagagcgccaaggagttctaccatcca
tcagagtactcttatcttacggtcaacactacatcgtcacacgacatgtcaactcttcgt
ggatggtgggaggaagacagaactcgctcacaaaacttttacaacaacatcttgggaatg
tatggtgaagctccctacttttgcgagccatatgttaccgaggccgtcattgtccaacat
cttcaatcgcagtcgatgatctctatcttcccattgcaagactggtttggtctgtcttcc
gagctctcgtcccgtgaccccaaggaggaaaagattaacgagccatccaatccattccac
tattggagatacagatgtcacgtcaatttggaagaccttttggaaaaccaagaattcaac
aagactatccaaagattaattatctcttcaaacagaaagcttgaagataccaataattaa

DBGET integrated database retrieval system