KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_01414Help
Entry
DFA_01414         CDS       T02668                                 

Definition
delta 9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DFA_01414
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DFA_01414
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     DFA_01414
Lipid biosynthesis proteins [BR:dfa01004]
 Desaturase
  First
   DFA_01414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 660 aa AA seqDB search
MTATVASSPISSTVQEVLHEMVSKLPKDIFEKSTSKATRRILVSVGLVTAGVVMIYNLPW
YLLPLGWLFMGTACCGLFSVGYACGKNLLFKNRAINYTVGTILMLPLMYPFEYWKRSTGE
VRDYVRDLAKGPYWWLMSLRQWATSNVASLDSRRMLLSAAALYLFASIFLPLMTYGFGLW
VPRFVQYLTQDFNIGVILARLQTQAENSVNAVIDFPPAYKWKEAYHVLKKEYQLNISEEN
IMDVLLKVGPLAKKIICPQPEQEQQQQPLEAPKKKSIFDGKPWYEKVVWTTTIFIFATPL
LSMYGIATSPFNWKTYVTAFCSYYIAGIGITAGYHRLFSHRSYDAVWPVRVILTLMGTTA
FEMSVIDWCHDHRAHHRFTDTDKDPYNVKKGFWWAHMGWLIFKREEEPDADVTDLKNDWV
LYYQHKYYTPLSLFFGIFLPTWICGHYWGDWRGGFFIAGIASKVLMMQCTFCINSLAHYL
GEATYTDQKSPRDSAITSLVTFGEGYHNFHHEFPYDYRNGIHHSAYDPGKWLIGFLSWFG
LSYNLKRFPAELFEKGKIQMAEKKAADARAKLFWGKPLDQLDIIDRETVKRTCADKGKKW
IIIHDIVYDVEEFQAKHPGGVQFIKDYIGKDASKAFDGLVYNHSFAARNILDTYRIAKLK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacagctacagtagcttcatctcccatttcatcgactgtacaagaagtactccatgaa
atggtttcaaaattaccaaaagatatatttgaaaaaagtacaagtaaagcaactagaaga
atattagtatcagttggtttagtcacggcaggtgtagtgatgatttataatttaccttgg
tacttgttgcctttgggatggttgtttatgggaactgcttgttgtggattgttctcggtc
ggatacgcctgtggaaagaacctgctcttcaagaaccgtgccattaactacactgtggga
actattttgatgttgcctcttatgtacccttttgagtactggaaacgtagtactggagag
gtacgtgactatgtgcgtgacttggccaagggtccatactggtggttaatgtcgcttcgt
caatgggccacctccaacgttgcttcattggacagtcgtcgtatgctcttgtcagctgct
gcactctacttgtttgcctcgatctttttgccgctgatgacctatggatttgggttgtgg
gtcccacgttttgtccaatacttgacacaagactttaacattggtgtcattctcgctcgt
ctccaaactcaagctgagaactcggtcaacgcagtcattgacttccccccagcctacaag
tggaaagaagcataccatgtcctcaaaaaggagtaccaattaaatatctctgaagaaaac
atcatggatgttttactcaaagttggtccactcgccaaaaaaatcatttgtccccaacct
gaacaagaacaacaacaacaaccattagaagcaccaaagaaaaagagtattttcgatggt
aaaccatggtatgaaaaggttgtttggacaactactatctttatctttgctacaccgttg
ttgtccatgtacggtattgcaacatcgccattcaactggaagacctatgtcactgcattt
tgcagctactatattgccggtattggtattactgctggataccatcgtctcttctcgcat
cgttcctacgacgctgtctggcccgtccgtgtcattctcacgttgatgggtaccactgcc
tttgagatgagcgtgattgactggtgtcacgaccatcgtgctcaccaccgattcaccgat
accgacaaagacccctacaatgtcaaaaaggggttctggtgggcacacatgggatggctc
atctttaagcgcgaggaagaacccgatgccgatgtgaccgacctcaagaacgactgggta
ctctactaccaacacaaatactataccccgctctccttgttctttggtatctttttgccc
acatggatctgcggtcactattggggtgactggcgcggtggctttttcatcgctggtatt
gcctccaaggtactcatgatgcaatgcactttctgtatcaactcgcttgcccattatctc
ggtgaagccacctacactgatcaaaagtcgcctcgtgactctgccatcacctcacttgtc
acctttggcgagggttaccacaactttcaccacgaattcccatacgactatcgtaacggt
atccaccactcggcctacgatcctggtaaatggttgattggcttcttgtcgtggtttggt
ctctcgtacaacctcaagcgtttcccagccgaactctttgaaaagggcaagatccaaatg
gccgaaaagaaggctgcagacgcccgtgccaagctcttttggggaaaaccacttgaccaa
ctcgacattatcgatcgtgaaaccgtcaaacgtacctgtgccgacaagggtaagaaatgg
atcatcattcacgacattgtctatgacgtagaagaattccaagccaaacatccaggtggc
gtccaattcatcaaggattatattggtaaagatgcatcaaaagcttttgatggtcttgtc
tataaccattcctttgctgctagaaatattctagatacttatcgtattgctaaattaaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system