KEGG   Cavenderia fasciculata (cellular slime mold): DFA_02272Help
Entry
DFA_02272         CDS       T02668                                 

Gene name
ucr
Definition
(RefSeq) ubiquinol-cytochrome-c reductase subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00190  Oxidative phosphorylation
dfa01100  Metabolic pathways
Module
dfa_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    DFA_02272 (ucr)
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     DFA_02272 (ucr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rieske UCR_TM
Motif
Other DBs
NCBI-GeneID: 14871180
NCBI-ProteinID: XP_004366662
UniProt: F4PZ00
Position
Unknown
AA seq 219 aa AA seqDB search
MLSRFVSRVTPLARQSLVNGQMNYSSGYMVDNTTSVPNFDKYRKHSSAADPEGRGYTYLV
VGAAASGLAAMAKNTVVSALSTMAPGQDILALSSIEIDLSSIPEATAVTLKWRGKPLFIR
HRSADEISQSQAVDVSTLVDPQADVKRAKDPEWIVLIGVCTHLGCIPIAGGGDFGGWYCP
CHGSHYDNAGRIRKGPAPENLIIPPYKFLSPTSIIVGDE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaagattcgtatcaagagttacaccattggccagacaatcattggttaatggt
caaatgaactactctagtggttatatggttgacaatactactagtgtaccaaactttgat
aaatatagaaagcactcttcagccgctgacccagagggacgtggttacacctatttggta
gttggagctgctgcttcaggtcttgccgctatggccaagaacactgttgtctctgctctt
tccaccatggccccaggtcaagatattttggctctttcatcaattgaaatcgacttgtca
tcgattccagaagccaccgccgtcaccttgaaatggagaggcaagccactctttattcgt
catcgttcggccgatgaaatctcccaaagccaagccgtcgacgtttctactttggtcgat
ccacaagcagatgtcaagcgtgccaaggatccagaatggatcgtcctcattggtgtctgc
acccatcttggttgcattccaattgccggtggtggtgactttggtggatggtactgtcca
tgccacggttctcattatgataacgctggtcgtattcgtaagggtccagccccagaaaat
cttatcatcccaccatacaagttcttgtctccaacctccatcattgttggtgatgaataa

DBGET integrated database retrieval system