KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_02272Help
Entry
DFA_02272         CDS       T02668                                 

Gene name
ucr
Definition
ubiquinol-cytochrome-c reductase subunit
Orthology
K00411  
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    DFA_02272 (ucr)
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     DFA_02272 (ucr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 219 aa AA seqDB search
MLSRFVSRVTPLARQSLVNGQMNYSSGYMVDNTTSVPNFDKYRKHSSAADPEGRGYTYLV
VGAAASGLAAMAKNTVVSALSTMAPGQDILALSSIEIDLSSIPEATAVTLKWRGKPLFIR
HRSADEISQSQAVDVSTLVDPQADVKRAKDPEWIVLIGVCTHLGCIPIAGGGDFGGWYCP
CHGSHYDNAGRIRKGPAPENLIIPPYKFLSPTSIIVGDE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaagattcgtatcaagagttacaccattggccagacaatcattggttaatggt
caaatgaactactctagtggttatatggttgacaatactactagtgtaccaaactttgat
aaatatagaaagcactcttcagccgctgacccagagggacgtggttacacctatttggta
gttggagctgctgcttcaggtcttgccgctatggccaagaacactgttgtctctgctctt
tccaccatggccccaggtcaagatattttggctctttcatcaattgaaatcgacttgtca
tcgattccagaagccaccgccgtcaccttgaaatggagaggcaagccactctttattcgt
catcgttcggccgatgaaatctcccaaagccaagccgtcgacgtttctactttggtcgat
ccacaagcagatgtcaagcgtgccaaggatccagaatggatcgtcctcattggtgtctgc
acccatcttggttgcattccaattgccggtggtggtgactttggtggatggtactgtcca
tgccacggttctcattatgataacgctggtcgtattcgtaagggtccagccccagaaaat
cttatcatcccaccatacaagttcttgtctccaacctccatcattgttggtgatgaataa

DBGET integrated database retrieval system