KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_02482Help
Entry
DFA_02482         CDS       T02668                                 

Gene name
odhA
Definition
oxoglutarate dehydrogenase
Orthology
K15791  
probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 [EC:1.2.4.2]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1052 aa AA seqDB search
MLSRSISSTISSRAMLLTRNASVLVNNKSYSSQSTVVAATKLFVNGYRANGHLKANIDPL
ARMERLTPKSLSASTYGLETADKLTVKGVLNALDNKDMTVTEIQQYLERVYCGDMTVQFE
HIESEDEKLWLYNQFEQLQQQDFTTQEKVNILKQLVKSEVFDHFMQKKFTTTKRYGLEGN
ESMMVACESIFRESSNSGIENIVIGMPHRGRLNLLVKTLNYPAVDLFWKVKGNSELAPGI
EGIGDVISHIGVSSTLSYPKGSVNVSLIHNPSHLEAADPVALGKTRAKQMYDNDIEQKDR
SMCLMMHGDAAVTGQGVVTESLQLSQLPGFNVGGCVHIIVNNQLGFTTIPKNGRSTRYSS
DVGKFVGCPIIIVNSQNPEMVERAARLAIQYRQQFKKDIIIDLIGWRKYGHNEIDEPSFT
QPTMYNNIRKRTSIPQMYAQQLQQQGVFSAEQLDSFTKAEHSLLEKDFEQLANFSHKPAD
HLQGKWEGLIQSVKIQNPSTIDTGYNKSKLVDILKQSVQVPEDFTVHNRLVKSFSNVRVE
RAQESQVDWASAETAAVGSLMQQGFNVRISGQDVGRGTFSQRHWELVEQKSDKVYSPLNH
MNLEGQLDIVNSNLSEFAVMGYEYGYSIESPKTLPIWEAQFGDFVNGAQIIVDQFLSNGE
SKWLRQSALTLLLPHGFDGAGPEHSSCKMERFLQLCDTEAVNVKDDKLISRETNIRQMMR
NYRKPLVVVGPKVLLRHPQCVSSLDEMSEGTHFQPVLSDAETVAPEIASKVERVIFCSGK
IYYDLVEERKKHSLSTAIVRLEELNPFPYGEIEQQLNRYGNATKFYWVQEEQQNAGAWSF
VEPRFKQRWSRTSSIKYIGRDPLCASAIGISTIHKKEATKLISTTTIKTLLFMMEQYSHT
KYSNIKNEQPLEKIYINYPFSTSIPHKLVGLIEQEQYQQQLDKLIKCHKMIRKYMTLSFI
IALLPFITSLLMVIIGAKTFSWRMAGYSILALTLLVLVSFWSIFLRIVNNHLYDSLNNNQ
QFKSSGIIFDYQFNSNFSSLCLIVILLSHHQP
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgttatcacgatcaatatcatcaaccatttccagtagggcaatgttgttgacaagaaat
gcatctgtactagtaaacaacaagtcatattcatcacaatcaacagtagtagcagcaacc
aagttatttgtaaatggttatagagccaatggtcatttaaaggcaaacattgatccattg
gcaagaatggaaagattgacaccaaaatcactttctgcttctacctatggtttagagact
gcagataaattgactgtaaaaggtgtattgaatgcattagacaacaaggatatgactgtc
actgaaattcaacaatatcttgaacgtgtctattgtggtgatatgactgttcaatttgag
cacattgaatcagaagatgaaaagttgtggctctacaatcaattcgaacaacttcaacaa
caagatttcactactcaagaaaaggttaatatcttgaagcaattggtaaagtctgaagta
tttgatcattttatgcaaaagaaatttactactacaaaaagatatggattagaaggtaat
gaaagtatgatggtagcatgtgaaagtatttttagagaatctagtaattctggtatcgag
aatattgtcattggaatgccacacagaggtagacttaatcttttggtaaaaacattaaac
tatccagcagttgatctcttttggaaggtaaaaggtaattctgaattggcacctggtatc
gaaggtattggtgatgttatctctcatattggtgtctcttccactcttagttatccaaag
ggatctgtcaacgtttcacttatccacaatccatcgcatcttgaagctgccgatccagtt
gccctcggaaaaacacgtgccaagcaaatgtatgacaatgacattgaacaaaaggataga
tcaatgtgtcttatgatgcatggtgatgctgctgtcactggtcaaggtgttgttacagag
tctctacaactctctcaattgccaggattcaatgttggtggatgtgttcacatcattgtc
aacaatcaacttggtttcactactattccaaagaatggtcgttccactcgttactctagt
gatgttggaaagtttgtaggttgtccaatcatcattgtcaactctcaaaatccagaaatg
gtagagagagctgctaggttggccattcaataccgtcaacaattcaaaaaggatatcatc
attgatttgattggttggagaaagtatggtcacaatgaaatcgacgagccttcattcaca
caaccaaccatgtacaacaacattcgtaaacgtacctctattccacaaatgtatgctcaa
caactccaacaacaaggtgtcttttctgccgaacaattagattcattcacaaaggcagag
cattctcttcttgaaaaggactttgaacaacttgccaacttttctcacaaaccagccgat
catctccaaggtaaatgggagggtctcattcaatcagtcaagatccaaaatccatccacc
atcgatactgggtacaacaagtccaagttggtagatatcctcaagcaatcggtacaggtt
ccagaagactttaccgttcacaatcgtcttgtcaaatctttctcaaatgttcgtgttgaa
cgtgctcaagaaagtcaagtcgattgggcatctgctgaaactgctgcagttggcagtctt
atgcaacaaggattcaatgtccgtatctctggtcaagatgtaggaagaggaaccttttca
caacgtcattgggagttggttgaacaaaaatcagacaaggtctactctccactcaaccac
atgaatctcgagggacaattagacattgtcaatagcaatctctcagagtttgctgtcatg
ggctacgaatatggttattctatcgaatcgccaaagactcttcccatttgggaggctcaa
tttggtgactttgtaaatggtgctcaaatcattgtcgatcaattcttgtcaaacggtgaa
tcgaaatggttgcgtcaaagtgcactcacccttcttcttccacatggtttcgatggtgct
ggtccagaacactcttcttgcaaaatggaacgtttcctccaactatgcgacactgaagca
gtcaatgtcaaggatgataagctcatcagtcgtgaaaccaacatacgtcaaatgatgcgt
aactaccgtaagccactcgttgtcgttggtccaaaggtccttcttagacatccacaatgt
gtatcaagcctcgatgaaatgtcagaaggcactcacttccaaccggtactctctgatgca
gagactgtcgcaccagaaattgcaagcaaggtcgagagagtcatcttttgttctggcaag
atctattatgatttggttgaagagagaaagaaacactcactctctacagccattgttcgt
ctagaggaactcaatccattcccatacggtgaaattgaacaacaactcaatcgttatggt
aacgccaccaaattctattgggtacaagaggaacaacaaaatgcaggtgcctggagcttt
gttgaaccaagattcaaacaacgttggtcaagaacatcgtctattaaatatattggaaga
gacccattgtgtgcaagtgctatcggtatctctaccattcacaaaaaggaggctactaaa
ttaattagtacaacaacaattaaaactttattattcatgatggaacaatattcacataca
aaatattcaaatattaaaaatgaacaacctctagaaaagatatacataaactatcccttt
tctacgagtattcctcacaaattggtcggattaatagaacaagaacaatatcaacaacaa
ttagataaattaattaaatgtcataaaatgattaggaaatatatgacactgtcgtttatc
attgccttgttaccatttataacatcacttttaatggttattattggtgctaaaacattt
tcttggcgaatggcgggttactctattttggctttaactttattagtattggtatcattt
tggtctatattccttagaattgtaaataatcacctctatgatagtttaaataataatcaa
caatttaaatctagtggtattattttcgattatcaatttaatagtaatttttctagtctt
tgtttaattgttatattactatcacatcatcaaccttaa

DBGET integrated database retrieval system