KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_02711Help
Entry
DFA_02711         CDS       T02668                                 

Definition
alanine transaminase
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DFA_02711
   01210 2-Oxocarboxylic acid metabolism
    DFA_02711
   01230 Biosynthesis of amino acids
    DFA_02711
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DFA_02711
Enzymes [BR:dfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DFA_02711
Amino acid related enzymes [BR:dfa01007]
 Aminotransferase (transaminase)
  Class I
   DFA_02711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 517 aa AA seqDB search
MFRRACTLFSNTTASTVGRATQQPIISNTNNLNLSFNRSSLKMNNNQSYSKSMTMDNICP
TVKTAQYAVRGELVIIAESLAKKLQEQQKNNTEKSLPFDEIVYCNIGNPQQLKQKPITYF
RQVLSLCEYPGMLDSAHIDKIFPSDVITRARELLGSINFTTGAYSGSQGIAHVTKNVASF
IESRDGHPSDPSDIFLTDGASVAVQRILRLLIRDRNDGILIPIPQYPLYSATIELYGGSQ
VGYELNEEKGWGLEIPELERSLKQSIDAGIQPRALVIINPGNPTGQSLDRANMEDIVRFC
HQHRLVLLADEVYQENVYVKEKKPFVSFKKVVKDLGQEVEGLELVSFHSVSKGVVGECGK
RGGYMELCNIDTAVKAEIYKLASIGLCPNVTGQLVVDLMVKPPVKGEPSYETYQKETETI
YESVTCNPPEGAMYAFPQIRLPARAVEEAKRLGKAPDAFYCINLLEATGVCVVPGSGFGQ
KDGTFHFRTTFLPSEQAIEGVCTRIADFHSKFMAKYK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagagcttgtacacttttttcaaatactacagcctcaacagtaggaagagca
acccaacaaccaataatcagcaacaccaacaatctaaatctatcatttaatcgttcaagt
ctcaaaatgaataacaatcaatcatactctaaatcaatgacaatggataatatttgtcca
actgtcaagacagcacaatatgcagtaagaggagaattagttatcattgcagaaagttta
gccaagaagcttcaagaacaacaaaaaaataacactgaaaagtctttgccatttgatgag
attgtttattgcaacattggtaatcctcaacaattaaagcaaaagcctattacctatttc
cgtcaagtgttgtcactttgcgagtatccaggcatgctcgacagtgctcacattgataaa
atcttcccatcagatgtcattactcgtgctcgtgaattgttgggatcgattaatttcaca
accggtgcctattcaggttcacagggtattgcacatgtaacaaaaaatgttgccagcttt
atcgagagccgtgatggtcatccatcagacccaagtgacatctttttgaccgatggtgct
tctgttgcagtccaacgtattcttcgtctcttgattcgtgatcgtaacgacggtatcctc
attcccatcccacaatatccattgtacagcgcaaccattgaattgtatggaggatcacaa
gttggttatgaattgaacgaagaaaagggatggggtctcgaaatcccagaactagagcgt
tctctcaagcaatcaatcgacgcaggaattcaaccacgtgcccttgttatcatcaaccca
ggaaatccaaccggtcagtcactcgatcgtgcaaacatggaagacattgtacgtttttgt
caccaacacagactcgtcctcttggccgatgaagtctatcaagaaaatgtctacgtcaag
gaaaagaagccatttgtatctttcaaaaaggtcgtcaaggatctcggtcaagaagtagaa
ggtctagagttggtttctttccattccgtctccaagggtgttgttggcgagtgtggtaag
cgtggtggatacatggagctctgtaacattgacactgctgtaaaggcagagatttacaag
ttggcttccatcggtctctgcccaaatgttaccggtcaacttgttgtcgatctcatggtc
aagccaccagtcaagggagaaccatcctatgaaacctatcaaaaggaaaccgaaaccatc
tatgaaagtgtcacatgcaatccaccagaaggtgccatgtatgccttccctcaaatcaga
ctcccagccagagctgtcgaagaggccaagcgtttaggaaaggccccagatgccttttat
tgcatcaacttgctcgaagctactggtgtttgcgtcgtaccaggcagcggctttggtcaa
aaggatggaaccttccatttccgtacaactttccttccatcagaacaagctatcgaaggt
gtttgcactagaattgctgatttccattcaaagtttatggcaaaatataaataa

DBGET integrated database retrieval system