KEGG   Cavenderia fasciculata (cellular slime mold): DFA_02711Help
Entry
DFA_02711         CDS       T02668                                 

Definition
(RefSeq) alanine transaminase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00220  Arginine biosynthesis
dfa00250  Alanine, aspartate and glutamate metabolism
dfa01100  Metabolic pathways
dfa01200  Carbon metabolism
dfa01210  2-Oxocarboxylic acid metabolism
dfa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DFA_02711
   00220 Arginine biosynthesis
    DFA_02711
Enzymes [BR:dfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DFA_02711
Amino acid related enzymes [BR:dfa01007]
 Aminotransferase (transaminase)
  Class I
   DFA_02711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 14876826
NCBI-ProteinID: XP_004362319
UniProt: F4PHY1
Position
Unknown
AA seq 517 aa AA seqDB search
MFRRACTLFSNTTASTVGRATQQPIISNTNNLNLSFNRSSLKMNNNQSYSKSMTMDNICP
TVKTAQYAVRGELVIIAESLAKKLQEQQKNNTEKSLPFDEIVYCNIGNPQQLKQKPITYF
RQVLSLCEYPGMLDSAHIDKIFPSDVITRARELLGSINFTTGAYSGSQGIAHVTKNVASF
IESRDGHPSDPSDIFLTDGASVAVQRILRLLIRDRNDGILIPIPQYPLYSATIELYGGSQ
VGYELNEEKGWGLEIPELERSLKQSIDAGIQPRALVIINPGNPTGQSLDRANMEDIVRFC
HQHRLVLLADEVYQENVYVKEKKPFVSFKKVVKDLGQEVEGLELVSFHSVSKGVVGECGK
RGGYMELCNIDTAVKAEIYKLASIGLCPNVTGQLVVDLMVKPPVKGEPSYETYQKETETI
YESVTCNPPEGAMYAFPQIRLPARAVEEAKRLGKAPDAFYCINLLEATGVCVVPGSGFGQ
KDGTFHFRTTFLPSEQAIEGVCTRIADFHSKFMAKYK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagagcttgtacacttttttcaaatactacagcctcaacagtaggaagagca
acccaacaaccaataatcagcaacaccaacaatctaaatctatcatttaatcgttcaagt
ctcaaaatgaataacaatcaatcatactctaaatcaatgacaatggataatatttgtcca
actgtcaagacagcacaatatgcagtaagaggagaattagttatcattgcagaaagttta
gccaagaagcttcaagaacaacaaaaaaataacactgaaaagtctttgccatttgatgag
attgtttattgcaacattggtaatcctcaacaattaaagcaaaagcctattacctatttc
cgtcaagtgttgtcactttgcgagtatccaggcatgctcgacagtgctcacattgataaa
atcttcccatcagatgtcattactcgtgctcgtgaattgttgggatcgattaatttcaca
accggtgcctattcaggttcacagggtattgcacatgtaacaaaaaatgttgccagcttt
atcgagagccgtgatggtcatccatcagacccaagtgacatctttttgaccgatggtgct
tctgttgcagtccaacgtattcttcgtctcttgattcgtgatcgtaacgacggtatcctc
attcccatcccacaatatccattgtacagcgcaaccattgaattgtatggaggatcacaa
gttggttatgaattgaacgaagaaaagggatggggtctcgaaatcccagaactagagcgt
tctctcaagcaatcaatcgacgcaggaattcaaccacgtgcccttgttatcatcaaccca
ggaaatccaaccggtcagtcactcgatcgtgcaaacatggaagacattgtacgtttttgt
caccaacacagactcgtcctcttggccgatgaagtctatcaagaaaatgtctacgtcaag
gaaaagaagccatttgtatctttcaaaaaggtcgtcaaggatctcggtcaagaagtagaa
ggtctagagttggtttctttccattccgtctccaagggtgttgttggcgagtgtggtaag
cgtggtggatacatggagctctgtaacattgacactgctgtaaaggcagagatttacaag
ttggcttccatcggtctctgcccaaatgttaccggtcaacttgttgtcgatctcatggtc
aagccaccagtcaagggagaaccatcctatgaaacctatcaaaaggaaaccgaaaccatc
tatgaaagtgtcacatgcaatccaccagaaggtgccatgtatgccttccctcaaatcaga
ctcccagccagagctgtcgaagaggccaagcgtttaggaaaggccccagatgccttttat
tgcatcaacttgctcgaagctactggtgtttgcgtcgtaccaggcagcggctttggtcaa
aaggatggaaccttccatttccgtacaactttccttccatcagaacaagctatcgaaggt
gtttgcactagaattgctgatttccattcaaagtttatggcaaaatataaataa

DBGET integrated database retrieval system