KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_02995Help
Entry
DFA_02995         CDS       T02668                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DFA_02995 (glgB)
Enzymes [BR:dfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DFA_02995 (glgB)
Exosome [BR:dfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DFA_02995 (glgB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 678 aa AA seqDB search
MTKDFSKATDGTKVISDDPWLEPYAQTLQRRHSHIDYMVNQFKEKEGGLKAFAEGYKFFG
FNITNEGVHYREWLPSAHGVTLVGDFNGWNKESHPLERDEYGRWYIFLKNTEDGKCAIPH
GSKIKIYVKLQNGNWDYRIPAWIHRVEQTKDNPVFDGVFWNPAQKYTFKHKSPAPPAAGL
RIYEAHVGMSSENPEISSYKKFRETVLPQIKELGYNCVQLMAIMEHAYYASFGYQVTNFF
AISSRFGTPEELMEMIDAAHEMGLLVFLDVVHSHASKNVLDGLNQLDGSDHHYFHSGGRG
NHDVWDSRLFNYSNWEVLRFLLSNLRFFVDKYHFDGFRFDGVTSMIYYHHGLAPACSYDD
YFGPAVDEDGLYYLSLANTLLKELNPNIITIAEEVTGMACLCRPIAEGGYGFDYRLGMGI
PDKWIELVKTKDEEWSMATISHMLSNRRYKERNISYAESHDQSLVGDKTLAFWLMDKEMY
DQMSTTSPITPIISRGMSLHKMIRLITSALGGDGYLNFMGNEFGHPEWVDFPRAGNNESY
HHARRRWDLHRDKLLRYHQLRNFDIAMNQLEDKTKWLIDSQAFISCKHEDDKVIVFERAG
LIFVFNFHPFKSFSDYRVGSGSSGKYANVLDSDREEFGGFCRIGTTPHFTEAVPWHDRTH
SLKVYIPSRTCLVLQKVD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagattttagtaaagcaactgatggtactaaagtcatatcagacgacccatgg
ttagaaccatatgcacagacacttcaaagaagacactcacatatcgattacatggtcaac
caatttaaagaaaaggaaggtggattaaaggcatttgcagaaggttacaaattctttggt
ttcaatatcacaaatgaaggtgtacattatcgtgaatggttaccatctgctcatggtgta
actttggttggtgattttaatggatggaataaagaaagtcatccacttgaaagagatgaa
tatggtagatggtatatatttttaaagaatacagaggatggtaaatgtgccattccacac
ggctccaagataaagatatatgtaaagttgcaaaacggtaattgggactaccgtattcca
gcctggatccatagagtcgagcaaaccaaagacaatccagtgtttgacggtgtattttgg
aacccagctcaaaagtatacattcaagcacaagtcacctgcccctccagccgccggcttg
cgtatctatgaggctcatgttggcatgtcgagtgagaacccagagatctcatcctacaaa
aagtttagagagaccgtgttaccacagatcaaagagttgggttacaactgcgtccagttg
atggctatcatggagcacgcctactatgcatcgtttggttaccaagtcaccaactttttc
gccattagcagtcgttttggtacacctgaagagttgatggagatgattgatgctgcccac
gaaatgggtctgctcgtgtttttggacgttgttcacagtcacgcttcaaagaatgttctc
gacggtctcaaccaattggatggttccgatcaccactactttcactcgggaggacgtggc
aaccacgatgtttgggatagcagactattcaattactccaattgggaagtacttcgtttc
ctcctttccaatctccgtttctttgtagataaatatcatttcgatggtttcagattcgat
ggtgtcacctctatgatttattatcatcacggtttagctcctgcttgttcctatgatgat
tattttggtcctgctgttgatgaagatggtttatattatttatctcttgcaaatacatta
ttaaaagaattaaatccaaatattataacaattgcagaagaggtaactggtatggcatgt
ctttgtcgtccaattgcagagggaggatatggatttgattatagattgggtatgggtatt
ccagacaaatggattgaattggtaaagacaaaggatgaggagtggagtatggcaaccatt
tcccatatgctttcaaatcgtcgttacaaggaaagaaacatctcttatgcagagtcacat
gatcagtcgttggtcggtgacaagacacttgccttttggttgatggacaaggagatgtat
gatcaaatgtcgaccaccagtcccatcacacccatcatttctcgtggcatgtcactacac
aagatgattagattgatcacatctgctcttggtggtgatggttatctcaactttatggga
aatgaatttggtcatcctgaatgggttgatttcccaagagctggcaacaatgaatcctat
catcacgccagacgtcgttgggatttacaccgtgataaattacttcgttatcaccaactt
cgtaatttcgatattgcaatgaatcaattggaagataaaactaaatggttaattgattct
caagcatttatatcatgtaaacatgaagatgacaaggtgattgtatttgaaagagcagga
cttatttttgtattcaatttccatccattcaagagtttctcagattatcgtgttggtagt
ggctcgagtggcaagtatgccaatgttttggattcagacagagaagagtttggaggtttt
tgtcgtatcggaaccactccccatttcactgaagctgttccatggcatgatcgcacccat
tcactcaaggtttacattccatcaagaacttgcctagttttacaaaaagttgattaa

DBGET integrated database retrieval system