KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_04785Help
Entry
DFA_04785         CDS       T02668                                 

Definition
putative cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DFA_04785
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DFA_04785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 647 aa AA seqDB search
MNNINSKILILFLIGLFSTIALADTCFNIDSLQWRTSGSKMMLNGVEIRVQGIAWFGLET
DSFSPGGLQQTSVEALLDILVNQNFNALRLPFSIDMILNDRWPSKINYGLNPGLQGKTAL
QVLDYIVAASAARGILAIPEQHRFDASAYIPDLWYSDSCIVNPSGQCVTYTEQMTIDTWV
SLVNRYKTYWNIWALDIKNEPHGRATWGTGNLATDWNQAFQRISNAILSRTTFPGVFFIE
GIENNANAICSYEVGNWWGGNMSPAQCFPVSLAQPNRHVYAPHTFCGSVYQQPYFGASNF
PSNMANIWNQHFGFLKTNDEPIIMGEWGCKNNDTKNNQWTDTFTKYLGSTSIKNHLFFSL
NPDSLDTDSILNGDYKTINQQVVNYIKQINTQPTKFTKVGNQICLGNIQNQSSSSTSDSD
SSSFDDNDDQDGGTVTPTTGSTSGASTTGSQSSTTGSQSSTTGSQSSTTGSPSTTGSQSS
TGSQTSTTGSQSSTTGSPSTTGSQSSTTGSQSSTTGSQSSTTTSGTTTSGSTTTTTTTGS
STTGTPTNKITIQQQLSSSWIQNGQTWAVYNAFLTNVGSTPIANLKLKVIDSSPAPIEAW
SAFMPSQSDATYWIPQTWALPLQPNQPVNFGYKIVSTAPIQFQAIIV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaataatattaatagtaaaatattaatattatttttaatcggtctattctcgacgatt
gcattggccgatacatgctttaatattgactcgttgcaatggcgtacttcgggctccaag
atgatgttgaatggagtggaaatccgtgttcagggtattgcctggtttggtctcgagact
gacagtttttcaccgggtggtttgcaacaaacctcggttgaagcattgctcgacattttg
gtgaaccaaaactttaatgccctccgtcttccattctcgatcgacatgattctcaatgac
agatggccatccaagatcaactatggtttgaatccaggtctccaaggaaagactgctctc
caagtgttggactatatcgtcgctgcctctgccgcccgtggtatccttgctattcccgag
caacatcgtttcgacgcatctgcctatattcccgacttgtggtattcagacagctgtatc
gtcaatccaagcggacagtgtgtcacctacactgaacaaatgaccattgatacatgggtg
tcgctcgtcaaccgttacaagacctactggaacatctgggcactcgacattaagaacgaa
ccacacggacgtgccacttggggaaccggtaaccttgccaccgactggaaccaagccttc
caacgtatcagtaatgccatcctctcgagaaccaccttcccaggtgtctttttcatcgag
ggtattgaaaacaatgccaacgccatctgctcgtacgaagttggtaattggtggggtggc
aacatgtcgcccgctcaatgtttcccagtgtcgctcgcacaacccaaccgtcacgtctat
gctccacacacattctgtggcagtgtctaccaacaaccatactttggtgcatccaacttc
ccatccaacatggccaatatctggaaccaacactttggattcctcaaaaccaatgacgag
ccaatcatcatgggcgaatggggttgcaagaacaacgacaccaaaaacaatcaatggacc
gacacttttacaaagtatctcggttcaaccagcatcaaaaaccatctcttcttctcgctc
aatccagattccctcgatactgactctatcttgaatggtgactacaaaaccatcaatcaa
caagttgtcaattatatcaagcaaatcaatactcaaccaactaaatttaccaaagttgga
aatcaaatttgtttaggtaatattcaaaatcaatcaagcagcagcactagtgacagtgat
agtagtagttttgatgacaatgatgatcaagatggtggtactgtaactccaactactgga
tcgacctctggagcatcgaccactggttcccaatcatcgaccactggatctcaatcatcc
acgacaggttctcaatcatccactactggatcaccatccactactggatcacaatcatct
actggttcccaaacatcgaccactggctcccaatcatcgaccactggatcaccatccact
actggctcccaatcatcaaccactggatcacaatcatcaaccactggatcacaatcatcg
acaactacctctggtactaccacctctggctctactactaccaccaccactactggttca
tcaaccactggtactccaactaacaaaattactattcaacaacaattgtcaagcagctgg
attcagaatggacaaacgtgggcagtatacaatgcattccttaccaacgttggatcgact
ccaattgccaatcttaagctcaaggttattgactcatcaccagcgccaatagaagcttgg
tctgcctttatgccaagtcaatctgacgctacctactggatcccacaaacatgggctctt
ccactccaaccaaatcaaccagttaactttggttacaagattgtttctactgctccaatc
caattccaagccatcattgtctaa

DBGET integrated database retrieval system