KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_04798Help
Entry
DFA_04798         CDS       T02668                                 

Gene name
thyB
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DFA_04798 (thyB)
Enzymes [BR:dfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DFA_04798 (thyB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 213 aa AA seqDB search
MFKNVVGKIGKIQVIYGPMFSGKTTELIRRIKRFNLTNQKCLLIKYSKDTRYNEIDRSLL
YTHDKQNYQAFPCSVLEEAKDKALDYDVIGIDEGQFFQDIVPFSEDLANRGKTVIVAALD
GTFQRKPFGTVLELVPKAESITKLTAVCMQCFKDAPFTKRIVPDETVELIGGADKYISVC
RECYHAEDINLNQNQNQNNNNRNNNNSNNSNKV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaacgtagttggtaaaataggaaagatacaagttatctatggcccgatgttt
agtggcaagactactgaactcattcgtcgaatcaagaggttcaatcttaccaatcaaaag
tgtctcctcattaaatacagtaaagatacaagatacaatgagatagaccgtagtctttta
tatacacacgacaaacaaaattatcaagcattcccatgttcagtgttggaagaagcaaag
gataaagcacttgattacgatgtaatcggtattgatgaaggtcaattttttcaagatata
gttccatttagtgaagatcttgctaatcgaggcaagactgtcattgttgcagcacttgat
ggtacattccaaagaaaaccctttgggactgtactcgagttggtcccaaaggcagagagc
attacaaagcttacagcggtttgcatgcaatgcttcaaagatgcaccattcaccaaaaga
atcgttcctgatgaaacggttgaactcattggaggagccgataaatatatatcagtttgt
agagaatgttatcatgctgaagatattaatttaaatcaaaatcaaaatcaaaataataat
aatagaaataataataatagtaataatagtaataaggtttaa

DBGET integrated database retrieval system