KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_04798Help
Entry
DFA_04798         CDS       T02668                                 

Gene name
thyB
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dfa00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 213 aa AA seqDB search
MFKNVVGKIGKIQVIYGPMFSGKTTELIRRIKRFNLTNQKCLLIKYSKDTRYNEIDRSLL
YTHDKQNYQAFPCSVLEEAKDKALDYDVIGIDEGQFFQDIVPFSEDLANRGKTVIVAALD
GTFQRKPFGTVLELVPKAESITKLTAVCMQCFKDAPFTKRIVPDETVELIGGADKYISVC
RECYHAEDINLNQNQNQNNNNRNNNNSNNSNKV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaacgtagttggtaaaataggaaagatacaagttatctatggcccgatgttt
agtggcaagactactgaactcattcgtcgaatcaagaggttcaatcttaccaatcaaaag
tgtctcctcattaaatacagtaaagatacaagatacaatgagatagaccgtagtctttta
tatacacacgacaaacaaaattatcaagcattcccatgttcagtgttggaagaagcaaag
gataaagcacttgattacgatgtaatcggtattgatgaaggtcaattttttcaagatata
gttccatttagtgaagatcttgctaatcgaggcaagactgtcattgttgcagcacttgat
ggtacattccaaagaaaaccctttgggactgtactcgagttggtcccaaaggcagagagc
attacaaagcttacagcggtttgcatgcaatgcttcaaagatgcaccattcaccaaaaga
atcgttcctgatgaaacggttgaactcattggaggagccgataaatatatatcagtttgt
agagaatgttatcatgctgaagatattaatttaaatcaaaatcaaaatcaaaataataat
aatagaaataataataatagtaataatagtaataaggtttaa

DBGET integrated database retrieval system