KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_04832Help
Entry
DFA_04832         CDS       T02668                                 

Gene name
elp3
Definition
elongation protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Brite
Enzymes [BR:dfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DFA_04832 (elp3)
Transfer RNA biogenesis [BR:dfa03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    DFA_04832 (elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 563 aa AA seqDB search
MSHIGDFRGAKQAATQTKNIKPVFGKGTPQFTKTIGEIVNALINAYKDGRQVNLLKLKTE
VAQRNSLSEQPKTVDIISAIPEDYKAALLPALKAKPVRTASGIAVVAVMCKPHRCPHIAM
TGNICIYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYLQTKSRIDQLKRLGHSVEK
VEFIIMGGTFMSLPADYRDYFIRNLHDALSGHTSNNVAEAVKYSEQSNIKCVGITIETRP
DHCLKLHLSNMLTYGCTRLEIGVQSVYEDIARDTNRGHTVKATLESFQLAKDSGFKVVAH
MMPDLPNMGMERDIYGFMEFFENPDFRADGLKIYPTLVIRGTGLYELWKTGTYKNYAPDA
LVDLIAKILALVPPWTRIYRIQRDIPMPLVTSGVEYGNLRELCLARMKDFGTKCRDVRTR
EVGIQEVHHKIKPDQVELIRRDYMANGGWETFLSYEDPKQDILIGLLRLRKCSEATFRPE
LKENCSIVRELHVYGSVVPIHNRDPTKFQHQGYGTLLMEEAERISREEHGSTKLAVIAGV
GTRHYYRKLGYELDGPYMSRSLL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacattggagattttagaggtgcaaagcaagcagctactcaaacaaagaatatt
aaacctgttttcggaaaaggaacaccacaatttacaaagacaatcggtgagattgtaaat
gcattgatcaatgcctacaaagatggaagacaagtcaatctattaaagttaaagacagag
gttgcacaaagaaactctttatcagaacaacccaaaacagttgatattatctctgcaatc
ccagaggattacaaagctgctttattacctgcattaaaagcaaagcctgttagaactgca
tcaggtattgcagtagtagctgttatgtgtaaaccacatagatgtccacacattgcaatg
acaggtaatatttgtatatattgcccaggaggaccagattcagattttgaatatagtaca
caatcatatacaggttatgaaccaacatcaatgagagcaattagagcaagatacaatcca
tatttgcaaacaaagagtcgtatcgatcaattgaaacgtttgggacatagtgttgaaaaa
gtagaatttattattatgggtggtacatttatgtctcttccagcagactatagagactat
tttattagaaatcttcatgatgcactcagtggacatacatcaaacaatgtagctgaagct
gtaaaatactctgaacagagtaacataaagtgtgtcggtatcactatagagacacgtcca
gatcattgtctcaaacttcatctttccaatatgcttacctatggttgtactcgtctagag
attggtgttcaatcagtctatgaagatattgcacgtgacactaatagaggacatactgtc
aaagctacacttgaaagtttccaattggccaaagatagtggtttcaaagtggtagcacac
atgatgccagatcttcccaatatgggtatggagagagatatctatggattcatggagttt
ttcgagaacccagatttccgtgccgatggtctcaagatttatccaacacttgtcattaga
ggtacaggtctctatgaactttggaagactggtacctacaaaaactatgcacccgatgct
cttgtagatctcattgcaaagattttggcactcgtaccaccttggacacgtatttatcgt
attcaacgtgatattccaatgccactcgtcacttcaggtgtagagtatggaaatcttaga
gagctgtgtttggcacgtatgaaggattttggtaccaagtgtcgtgatgttcgtacaaga
gaggttggtattcaagaggtgcatcacaagatcaaaccagatcaagtagaattgattcgt
cgtgactacatggccaatggtggttgggagacattcctctcttatgaagatccaaaacaa
gatattctcattggtcttcttcgtctaagaaagtgttcagaggcaacattccgtccagaa
ttaaaagaaaactgttctatcgtaagagaacttcatgtctatggtagtgttgtacccatt
cacaatagagatccaactaaattccaacatcaaggatacggtacactattgatggaagaa
gcagaacgtatatcaagagaagaacatggatcaactaaattggctgtcattgctggtgtt
ggtactcgtcattattatagaaaacttggttatgaattagatggtccatacatgtctcgt
agtcttttataa

DBGET integrated database retrieval system