KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_05004Help
Entry
DFA_05004         CDS       T02668                                 

Gene name
maoA
Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DFA_05004 (maoA)
   00330 Arginine and proline metabolism
    DFA_05004 (maoA)
   00340 Histidine metabolism
    DFA_05004 (maoA)
   00350 Tyrosine metabolism
    DFA_05004 (maoA)
   00360 Phenylalanine metabolism
    DFA_05004 (maoA)
   00380 Tryptophan metabolism
    DFA_05004 (maoA)
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     DFA_05004 (maoA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 461 aa AA seqDB search
MATQYDVIVIGGGLSGAQCAADLKSKGVNVLLIEARDRFGGRTESIKVEDYWFDLGGQWM
GGTHNILKKVCNELRIESFPQYDEGNHILELNNKHTLYKGNISTLNTDYNLEGLESTIAI
IDKMAEELDASKPYDHPRAKEWDNITLANWIRDNVKGSDAVKILNWFCKVCLAGEPTEIS
FLWYLLFIKAAGGYGVLADIRGGAQQDRLIGGSQQISERLVRERVGNFLLNCKVVGIHQD
NAGVTVLIEGGQRFRAKFVANTIPPALAGRIDYKPALPASRDSLTQRMPMGSVIKTIVIY
DEPFWRRDGFSAEALSEHGPIFICYDDSSHDDKANAIVGFIAGQDAREWSEKTPEVRKQA
VLECYARWFGPRALKPKYYLEKDWKTDEFARGAYLAFAQPGTLTACGKSLREPVGRMHFA
GTETATQWIGYMEGALESGLRCSKELQSRLQQDQQSYNSKL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccacacaatatgatgttattgttatcggaggaggtttatcaggagctcaatgtgct
gctgatttgaaatcaaagggtgttaatgtattattgattgaagctagagatagatttggt
ggacgtacagaatcgataaaggtagaagattattggtttgatttgggtggacaatggatg
ggaggtactcataacattctcaaaaaggtgtgtaatgaattacgtatcgaatcattccct
caatacgacgaaggaaaccatatactcgaattaaacaacaagcataccctctacaaggga
aacatctccaccttgaacactgactataacttggaaggtctcgaatccaccattgcaatc
attgacaagatggccgaagaattggatgcttccaaaccatatgatcatccaagagctaaa
gaatgggataatattacattggcaaattggatcagagataatgtaaagggatcggatgca
gttaagattttgaattggttctgtaaggtatgtttggcaggtgagccaacagagattagt
ttcttgtggtacttgcttttcatcaaggctgccggtgggtatggcgtgttggccgatatc
cgtggtggcgcccaacaagatcgtttgattggtggttcgcaacagatttcagagcgattg
gtgagagagcgtgtcggcaactttttgctcaactgcaaggtcgtcggcatccaccaagac
aatgccggtgtgaccgtgttgatcgagggtggccaacgtttccgcgccaagtttgttgcc
aacacgatcccacctgctttggccggtcgtatcgactacaaacccgctctcccagcttcg
cgtgattctctcacccaacgtatgccaatgggatcggttatcaagaccattgtcatctac
gacgaacctttctggcgtagagacgggttctcggccgaagcattgtccgagcacggtccc
atctttatctgctacgacgactcgtcgcacgacgacaaggcaaatgccatcgtcggcttt
atcgccggtcaagacgcacgcgagtggagtgaaaagacaccagaggtccgtaaacaagct
gtcctcgaatgctatgcccgttggtttggtccacgtgccctcaaaccaaagtactacctc
gaaaaggactggaagaccgacgagtttgccagaggtgcctatcttgcctttgcccaaccc
ggcaccctcaccgcctgcggcaagtcactccgcgaaccagtcggtagaatgcattttgcc
ggtactgaaacagctacccaatggatcggatacatggaaggtgctttggaaagtggtctc
cgttgttccaaagaattacaatcaagattacaacaagatcaacaatcttataattcaaaa
ctttaa

DBGET integrated database retrieval system