KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_05827Help
Entry
DFA_05827         CDS       T02668                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    DFA_05827
Enzymes [BR:dfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DFA_05827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 429 aa AA seqDB search
MIIGVVSGNNSDASGGFYQPGKTNVQMLNKDNFADNVFGTEHVWLVEFYAPWCGHCKSLK
PEYEKLATSLKGIAKIGAVNCDVEKELCGHFGIQGFPTIKFFPSELVPNKKEGKDAYHKV
PEDYQYGRTAKDMSQFITGKIPSFVKKVDADSKSISAFIAADKTAKALLFTDKPTTSSLY
KALSVDFHHTLPLGEVKKAKQDVLDKFKIKSFPTLLLFKSDSEEDVVVYTGKLNQEEIFK
FLSPFQNESNQKPNKFQKKGGNDKKQQQQQKPKEPEVPALDHALLINDQETFDLHCAKGG
LCSLFFLDLENEDERSSNDRYIDTMNQLAKKFVGRIKIFYVDGALQNNFVDELHLSGLPN
MIILNTSRMRYVNYLGSFSFDSAEEFYNDVLVGKKGTAPLKSIPKIISSKPSSSTKQQPT
KSTTAKDEL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatcataggtgtagttagtggaaataatagtgatgcatcaggaggattctatcaaccg
ggcaaaacaaacgtacaaatgttgaacaaggacaactttgccgacaacgtgtttggaacg
gagcatgtatggttggttgagttttacgcaccatggtgtggccattgcaagagtttgaag
ccagagtatgaaaagttggctacttcactcaagggtattgccaagattggtgctgtcaac
tgtgatgttgaaaaggagttgtgcggtcactttggtatccaagggttcccaacgatcaag
ttcttcccctctgaattagtaccaaacaaaaaggagggtaaagatgcctaccacaaggta
ccagaagactaccaatacggcagaactgccaaggacatgtcacaattcatcactggcaag
atcccatcctttgtcaaaaaggtcgatgccgactccaagtccatctctgcctttatcgcc
gccgacaagactgccaaagcactcctctttaccgacaaaccaactacctctagtctctac
aaagctctctctgtcgatttccaccatactcttccacttggtgaagtaaagaaagctaaa
caagatgttcttgacaaatttaaaattaaatcattcccaacattattattattcaagagt
gattcagaagaggatgtagttgtatacactggcaaattaaatcaagaagaaatctttaaa
ttcctttcaccattccaaaatgaatcaaatcaaaaaccaaacaaattccaaaagaagggt
ggtaatgataagaaacagcaacaacaacaaaaaccaaaggaaccagaagttccagcatta
gatcacgcacttttaattaatgatcaagagacatttgatttacattgtgccaagggtgga
ctatgttcactattctttttggatcttgaaaatgaagacgaacgttcatcaaacgatcgt
tacattgacactatgaaccaattggctaaaaagtttgtcggacgtatcaagatattctac
gtcgacggtgcacttcaaaacaactttgtcgatgaactccatctctctggtctccccaat
atgatcattctcaatacctctcgtatgagatatgtcaactatttgggttcattctctttt
gattctgcagaagagttttacaacgatgtattagtaggtaaaaagggtactgctccatta
aaatcaattccaaagattatctcttctaaaccatcttcatcaaccaaacaacaaccaact
aaatcaaccaccgcaaaggatgaattataa

DBGET integrated database retrieval system