KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_05983Help
Entry
DFA_05983         CDS       T02668                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DFA_05983
Enzymes [BR:dfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DFA_05983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 311 aa AA seqDB search
MGKITVIGASNWDMFTYCARIPVVGETIKGNDFKTSYGGKASNQAVQCALLGSECVGDDM
IGKNTIENFKSKNIDIKHVGLVKDVPSGCATIIVDSKGNNNIIIVGGSNDKLDQQDVIDA
TFTIQKSSYLLCQLEVSLETTFKALKVAKQPASSCKTILNLSPVTNDPLLMEMMEFVDIL
LLNEVELIGIAKKTEEKIDMTSMSTLHQLVLDSVMNKYPTIQSVIVTLGENGCLLVSRDY
KGIDQYTHVPVTEKVVAVDTTGAGDSFTGALAHYLDQSFDMAESISKASRVSAISVTRYG
TQTSYPSKSDL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagataacagtgattggggctagtaactgggatatgttcacctattgcgctaga
ataccggtagttggtgaaacaatcaaaggaaatgactttaaaactagctatggtggtaaa
gcatcgaatcaagccgttcaatgtgctttgcttggctctgaatgtgttggtgatgatatg
attggaaagaatacaatagagaatttcaaatcaaagaatatcgatatcaaacatgttggt
cttgtcaaagatgtaccatcaggttgtgcaaccatcattgtcgatagtaaaggaaataat
aatatcatcattgttggtggatcaaatgataaactagatcaacaagatgtcattgatgca
acttttaccattcaaaaatcaagttatctattatgtcaacttgaagtatctcttgaaaca
acatttaaagcattaaaagttgctaaacaacctgcttcatcttgcaagactatattaaat
ttatcacctgttacaaatgatccattgttaatggaaatgatggaatttgtagatatatta
ttattaaatgaagtagagttgattggaattgcaaaaaagacagaggaaaagattgatatg
acatcgatgagcactttgcatcagttggtgttggacagtgtcatgaacaaatatcctacc
attcaatcggttattgtcacattgggagagaatggatgtttgttggttagtcgagattac
aagggtatcgaccaatacactcatgtcccagttactgaaaaggtggtggctgtcgacaca
acaggtgctggtgacagcttcacaggtgcattggcacattatctcgatcaatcatttgac
atggctgaaagtatttcaaaagcaagtcgagtatcagccatatcagtaactagatatgga
actcaaactagttatccatctaaatctgatctttaa

DBGET integrated database retrieval system